Recombinant Human CCR9 protein, His-tagged
Cat.No. : | CCR9-30H |
Product Overview : | Recombinant Human CCR9 protein(1-74 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-74 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYW |
Gene Name | CCR9 chemokine (C-C motif) receptor 9 [ Homo sapiens ] |
Official Symbol | CCR9 |
Synonyms | CCR9; chemokine (C-C motif) receptor 9; GPR28; C-C chemokine receptor type 9; CDw199; GPR 9 6; G protein-coupled receptor 28; GPR-9-6; CC-CKR-9; |
Gene ID | 10803 |
mRNA Refseq | NM_001256369 |
Protein Refseq | NP_001243298 |
MIM | 604738 |
UniProt ID | P51686 |
◆ Recombinant Proteins | ||
CCR9-3960H | Recombinant Human CCR9 Protein, His tagged, Biotinylated | +Inquiry |
CCR9-381C | Recombinant Cynomolgus CCR9 Protein, His-tagged | +Inquiry |
CCR9-1371H | Active Recombinant Human CCR9 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CCR9-3499C | Recombinant Chicken CCR9 | +Inquiry |
CCR9-2621H | Recombinant Human CCR9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CCR9-13HCL | Recombinant Full Length Human CCR9 Over-expression Lysate, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR9-310HCL | Recombinant Human CCR9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCR9 Products
Required fields are marked with *
My Review for All CCR9 Products
Required fields are marked with *