Recombinant Human CCRL2 protein

Cat.No. : CCRL2-15H
Product Overview : Recombinant Human CCRL2 was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located.
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 39.5 kDa
AA Sequence : MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENI YLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGII TSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRK TLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Applications : Antibody Production; Functional Study: Recommended usage only, not validated yet; Compound Screening: Recommended usage only, not validated yet.
Notes : Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CCRL2 chemokine (C-C motif) receptor-like 2 [ Homo sapiens ]
Official Symbol CCRL2
Synonyms CCRL2; chemokine (C-C motif) receptor-like 2; C-C chemokine receptor-like 2; CKRX; CRAM A; CRAM B; HCR; chemokine receptor X; chemokine receptor CCR11; putative MCP-1 chemokine receptor; CRAM; CRAM-A; CRAM-B; FLJ55815; MGC34104; MGC116710;
Gene ID 9034
mRNA Refseq NM_003965
Protein Refseq NP_003956
MIM 608379
UniProt ID O00421
Chromosome Location 3p21
Pathway GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function CCR chemokine receptor binding; G-protein coupled receptor activity; chemokine receptor activity; chemokine receptor binding; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCRL2 Products

Required fields are marked with *

My Review for All CCRL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon