Recombinant Human CCRL2 protein
| Cat.No. : | CCRL2-15H |
| Product Overview : | Recombinant Human CCRL2 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located. |
| Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Molecular Mass : | 39.5 kDa |
| AA Sequence : | MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENI YLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGII TSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRK TLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV |
| Applications : | Antibody Production; Functional Study: Recommended usage only, not validated yet; Compound Screening: Recommended usage only, not validated yet. |
| Notes : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CCRL2 chemokine (C-C motif) receptor-like 2 [ Homo sapiens ] |
| Official Symbol | CCRL2 |
| Synonyms | CCRL2; chemokine (C-C motif) receptor-like 2; C-C chemokine receptor-like 2; CKRX; CRAM A; CRAM B; HCR; chemokine receptor X; chemokine receptor CCR11; putative MCP-1 chemokine receptor; CRAM; CRAM-A; CRAM-B; FLJ55815; MGC34104; MGC116710; |
| Gene ID | 9034 |
| mRNA Refseq | NM_003965 |
| Protein Refseq | NP_003956 |
| MIM | 608379 |
| UniProt ID | O00421 |
| Chromosome Location | 3p21 |
| Pathway | GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
| Function | CCR chemokine receptor binding; G-protein coupled receptor activity; chemokine receptor activity; chemokine receptor binding; receptor activity; signal transducer activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCRL2 Products
Required fields are marked with *
My Review for All CCRL2 Products
Required fields are marked with *
