Recombinant Human CCRL2 protein, GST-tagged
| Cat.No. : | CCRL2-16H |
| Product Overview : | Recombinant Human CCRL2(49 a.a. - 344 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 49-344 a.a. |
| Description : | This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 58.3 kDa |
| AA Sequence : | FVIGVLDNLLVVLILVKYKGLKRAENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCL LTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEYVVYKPQMEDQKYKCAFSRTPFLPADETFWKH FLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCK SSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CCRL2 chemokine (C-C motif) receptor-like 2 [ Homo sapiens ] |
| Official Symbol | CCRL2 |
| Synonyms | CCRL2; chemokine (C-C motif) receptor-like 2; C-C chemokine receptor-like 2; CKRX; CRAM A; CRAM B; HCR; chemokine receptor X; chemokine receptor CCR11; putative MCP-1 chemokine receptor; CRAM; CRAM-A; CRAM-B; FLJ55815; MGC34104; MGC116710; |
| Gene ID | 9034 |
| mRNA Refseq | NM_001130910 |
| Protein Refseq | NP_001124382 |
| MIM | 608379 |
| UniProt ID | O00421 |
| Chromosome Location | 3p21 |
| Pathway | GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
| Function | CCR chemokine receptor binding; G-protein coupled receptor activity; chemokine receptor activity; chemokine receptor binding; receptor activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| CCRL2-653HF | Recombinant Full Length Human CCRL2 Protein | +Inquiry |
| RFL26212MF | Recombinant Full Length Mouse C-C Chemokine Receptor-Like 2(Ccrl2) Protein, His-Tagged | +Inquiry |
| RFL27336HF | Recombinant Full Length Human C-C Chemokine Receptor-Like 2(Ccrl2) Protein, His-Tagged | +Inquiry |
| CCRL2-1425M | Recombinant Mouse CCRL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCRL2-15H | Recombinant Human CCRL2 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCRL2-311HCL | Recombinant Human CCRL2 cell lysate | +Inquiry |
| CCRL2-312HCL | Recombinant Human CCRL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCRL2 Products
Required fields are marked with *
My Review for All CCRL2 Products
Required fields are marked with *
