Recombinant Human CCT5, His-tagged
Cat.No. : | CCT5-27006TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 163-541 of Human TCP1 epsilon with an N terminal His tag. Predicted MWt: 43 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 163-541 a.a. |
Description : | The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. In addition, three pseudogenes of this gene have been identified. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 65 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERR DVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMP KKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQ KYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQ NNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFA GLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMI IEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALA VSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNP IQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIE TLIGKKQQISLATQMVRMILKIDDIRKPGESEE |
Gene Name | CCT5 chaperonin containing TCP1, subunit 5 (epsilon) [ Homo sapiens ] |
Official Symbol | CCT5 |
Synonyms | CCT5; chaperonin containing TCP1, subunit 5 (epsilon); T-complex protein 1 subunit epsilon; KIAA0098; |
Gene ID | 22948 |
mRNA Refseq | NM_012073 |
Protein Refseq | NP_036205 |
MIM | 610150 |
Uniprot ID | P48643 |
Chromosome Location | 5 |
Pathway | Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Folding of actin by CCT/TriC, organism-specific biosystem; Formation of tubulin folding intermediates by CCT/TriC, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; unfolded protein binding; |
◆ Recombinant Proteins | ||
CCT5-529H | Recombinant Human CCT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCT5-10898H | Recombinant Human CCT5, GST-tagged | +Inquiry |
CCT5-109H | Recombinant Human CCT5 protein, His-tagged | +Inquiry |
CCT5-001H | Recombinant Human CCT5 Protein, Myc/DDK-tagged | +Inquiry |
CCT5-1429M | Recombinant Mouse CCT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCT5-172HCL | Recombinant Human CCT5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCT5 Products
Required fields are marked with *
My Review for All CCT5 Products
Required fields are marked with *