Recombinant Human CD109 protein, His-tagged

• Cat.No.: CD109-3875H
• Product Overview: Recombinant Human CD109 protein(957-1041 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 957-1041 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MRQGYQRELLYQREDGSFSAFGNYDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGHQKSNGEFWDPGRVIHSELQGG
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CD109 CD109 molecule [ Homo sapiens ]
• Official Symbol: CD109
• Synonyms: CD109; CD109 molecule; CD109 antigen (Gov platelet alloantigens); CD109 antigen; CPAMD7; DKFZp762L1111; FLJ38569; p180; r150; Gov platelet alloantigens; activated T-cell marker CD109; platelet-specific Gov antigen; 150 kDa TGF-beta-1-binding protein; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7; RP11-525G3.1; FLJ41966
• Gene ID: 135228
• mRNA Refseq: NM_001159587
• Protein Refseq: NP_001153059
• MIM: 608859
• UniProt ID: Q6YHK3