Recombinant Human CD109 protein, His-tagged

Cat.No. : CD109-3875H
Product Overview : Recombinant Human CD109 protein(957-1041 aa), fused to His tag, was expressed in E. coli.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 957-1041 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MRQGYQRELLYQREDGSFSAFGNYDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGHQKSNGEFWDPGRVIHSELQGG
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CD109 CD109 molecule [ Homo sapiens ]
Official Symbol CD109
Synonyms CD109; CD109 molecule; CD109 antigen (Gov platelet alloantigens); CD109 antigen; CPAMD7; DKFZp762L1111; FLJ38569; p180; r150; Gov platelet alloantigens; activated T-cell marker CD109; platelet-specific Gov antigen; 150 kDa TGF-beta-1-binding protein; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7; RP11-525G3.1; FLJ41966;
Gene ID 135228
mRNA Refseq NM_001159587
Protein Refseq NP_001153059
MIM 608859
UniProt ID Q6YHK3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD109 Products

Required fields are marked with *

My Review for All CD109 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon