Recombinant Human CD163
Cat.No. : | CD163-27220TH |
Product Overview : | Recombinant fragment of Human CD163 with a proprietary tag: predicted molecular weight 35.64 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 91 amino acids |
Description : | The protein encoded by this gene is a member of the scavenger receptor cysteine-rich (SRCR) superfamily, and is exclusively expressed in monocytes and macrophages. It functions as an acute phase-regulated receptor involved in the clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages, and may thereby protect tissues from free hemoglobin-mediated oxidative damage. This protein may also function as an innate immune sensor for bacteria and inducer of local inflammation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Molecular Weight : | 35.640kDa inclusive of tags |
Tissue specificity : | Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed a |
Biological activity : | Useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMC |
Sequence Similarities : | Contains 9 SRCR domains. |
Gene Name | CD163 CD163 molecule [ Homo sapiens ] |
Official Symbol | CD163 |
Synonyms | CD163; CD163 molecule; CD163 antigen; scavenger receptor cysteine-rich type 1 protein M130; M130; MM130; |
Gene ID | 9332 |
mRNA Refseq | NM_004244 |
Protein Refseq | NP_004235 |
MIM | 605545 |
Uniprot ID | Q86VB7 |
Chromosome Location | 12p13 |
Function | protein binding; scavenger receptor activity; |
◆ Recombinant Proteins | ||
CD163-356H | Recombinant Human CD163 protein, His-tagged | +Inquiry |
CD163-10910H | Recombinant Human CD163, GST-tagged | +Inquiry |
CD163-0008P | Recombinant Pig CD163 Protein (Pro447-Ser577), C-His-tagged | +Inquiry |
CD163-27220TH | Recombinant Human CD163 | +Inquiry |
CD163-064H | Recombinant Human CD163 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD163-7683HCL | Recombinant Human CD163 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD163 Products
Required fields are marked with *
My Review for All CD163 Products
Required fields are marked with *
0
Inquiry Basket