Recombinant Human CD163

Cat.No. : CD163-27220TH
Product Overview : Recombinant fragment of Human CD163 with a proprietary tag: predicted molecular weight 35.64 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 91 amino acids
Description : The protein encoded by this gene is a member of the scavenger receptor cysteine-rich (SRCR) superfamily, and is exclusively expressed in monocytes and macrophages. It functions as an acute phase-regulated receptor involved in the clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages, and may thereby protect tissues from free hemoglobin-mediated oxidative damage. This protein may also function as an innate immune sensor for bacteria and inducer of local inflammation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Molecular Weight : 35.640kDa inclusive of tags
Tissue specificity : Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed a
Biological activity : Useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMC
Sequence Similarities : Contains 9 SRCR domains.
Gene Name CD163 CD163 molecule [ Homo sapiens ]
Official Symbol CD163
Synonyms CD163; CD163 molecule; CD163 antigen; scavenger receptor cysteine-rich type 1 protein M130; M130; MM130;
Gene ID 9332
mRNA Refseq NM_004244
Protein Refseq NP_004235
MIM 605545
Uniprot ID Q86VB7
Chromosome Location 12p13
Function protein binding; scavenger receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD163 Products

Required fields are marked with *

My Review for All CD163 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon