"CD177" Related Products

Expand
Expand

Recombinant Human CD177 protein, T7/His-tagged

Cat.No.: CD177-63H
Product Overview: Recombinant human CD177 (NTN4) gene (22 - 408 aa) fused with T7/His tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFELLLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESG PQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSME GCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGT TIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASY THFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGATHCYDGYIHLSGGGLST KMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGG
Purity: >90% by SDS-PAGE
Applications: 1. Protein can be used as coating matrix protein for study human neutrophil-endothelia cell interaction study in vitro.2. As highly purified recombinant antigen, it may be used as culture matrix protein for differentiation of human endothelial cell in vitro.
Storage: Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CD177 CD177 molecule [ Homo sapiens ]
Official Symbol: CD177
Synonyms: CD177; CD177 molecule; CD177 antigen; HNA2A; NB1; polycythemia rubra vera 1; PRV1; NB1 glycoprotein; cell surface receptor; human neutrophil alloantigen 2a; polycythemia rubra vera protein 1; PRV-1; HNA-2a; NB1 GP;
Gene ID: 57126
mRNA Refseq: NM_020406
Protein Refseq: NP_065139
MIM: 162860
UniProt ID: Q8N6Q3
Chromosome Location: 19q13.2
Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.