Recombinant Human CD177 protein, His-GST-tagged
Cat.No. : | CD177-513H |
Product Overview : | Recombinant Human CD177 protein(Q8N6Q3)(22-321aa), fused to N-terminal His and GST tags, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 22-321aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 63.6 kDa |
AA Sequence : | LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CD177 CD177 molecule [ Homo sapiens ] |
Official Symbol | CD177 |
Synonyms | CD177; CD177 molecule; CD177 antigen; HNA2A; NB1; polycythemia rubra vera 1; PRV1; NB1 glycoprotein; cell surface receptor; human neutrophil alloantigen 2a; polycythemia rubra vera protein 1; PRV-1; HNA-2a; NB1 GP; |
Gene ID | 57126 |
mRNA Refseq | NM_020406 |
Protein Refseq | NP_065139 |
MIM | 162860 |
UniProt ID | Q8N6Q3 |
◆ Recombinant Proteins | ||
CD177-0912H | Recombinant Human CD177 Protein (Cys133-Ser301), N-His tagged | +Inquiry |
CD177-248H | Recombinant Human CD177, Fc-tagged | +Inquiry |
CD177-962HFL | Recombinant Full Length Human CD177 Protein, C-Flag-tagged | +Inquiry |
CD177-5035H | Recombinant Human CD177 Protein (Met1-Gly407), C-His tagged | +Inquiry |
CD177-533H | Recombinant Human CD177 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD177-778HCL | Recombinant Human CD177 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD177 Products
Required fields are marked with *
My Review for All CD177 Products
Required fields are marked with *