Recombinant Human CD177 protein, His-GST-tagged

Cat.No. : CD177-513H
Product Overview : Recombinant Human CD177 protein(Q8N6Q3)(22-321aa), fused to N-terminal His and GST tags, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 22-321aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 63.6 kDa
AA Sequence : LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name CD177 CD177 molecule [ Homo sapiens ]
Official Symbol CD177
Synonyms CD177; CD177 molecule; CD177 antigen; HNA2A; NB1; polycythemia rubra vera 1; PRV1; NB1 glycoprotein; cell surface receptor; human neutrophil alloantigen 2a; polycythemia rubra vera protein 1; PRV-1; HNA-2a; NB1 GP;
Gene ID 57126
mRNA Refseq NM_020406
Protein Refseq NP_065139
MIM 162860
UniProt ID Q8N6Q3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD177 Products

Required fields are marked with *

My Review for All CD177 Products

Required fields are marked with *

0
cart-icon
0
compare icon