Recombinant Human CD177 protein, His-GST-tagged
| Cat.No. : | CD177-513H |
| Product Overview : | Recombinant Human CD177 protein(Q8N6Q3)(22-321aa), fused to N-terminal His and GST tags, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 22-321aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 63.6 kDa |
| AA Sequence : | LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | CD177 CD177 molecule [ Homo sapiens ] |
| Official Symbol | CD177 |
| Synonyms | CD177; CD177 molecule; CD177 antigen; HNA2A; NB1; polycythemia rubra vera 1; PRV1; NB1 glycoprotein; cell surface receptor; human neutrophil alloantigen 2a; polycythemia rubra vera protein 1; PRV-1; HNA-2a; NB1 GP; |
| Gene ID | 57126 |
| mRNA Refseq | NM_020406 |
| Protein Refseq | NP_065139 |
| MIM | 162860 |
| UniProt ID | Q8N6Q3 |
| ◆ Recombinant Proteins | ||
| CD177-0730H | Recombinant Human CD177 Protein, GST-Tagged | +Inquiry |
| CD177-2990HF | Recombinant Full Length Human CD177 Protein, GST-tagged | +Inquiry |
| CD177-0912H | Recombinant Human CD177 Protein (Cys133-Ser301), N-His tagged | +Inquiry |
| CD177-151H | Recombinant Human CD177 Protein, DYKDDDDK-tagged | +Inquiry |
| CD177-3041H | Recombinant Human CD177 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD177-778HCL | Recombinant Human CD177 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD177 Products
Required fields are marked with *
My Review for All CD177 Products
Required fields are marked with *
