Recombinant Human CD19
Cat.No. : | CD19-27864TH |
Product Overview : | Recombinant Human CD19 fragment, amino acids 98-187 with a proprietary N-terminal tag; molecular weight 35.53 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. |
Molecular Weight : | 35.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD |
Sequence Similarities : | Contains 2 Ig-like C2-type (immunoglobulin-like) domains. |
Gene Name | CD19 CD19 molecule [ Homo sapiens ] |
Official Symbol | CD19 |
Synonyms | CD19; CD19 molecule; CD19 antigen; B-lymphocyte antigen CD19; |
Gene ID | 930 |
mRNA Refseq | NM_001178098 |
Protein Refseq | NP_001171569 |
MIM | 107265 |
Uniprot ID | P15391 |
Chromosome Location | 16p11.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; |
Function | receptor signaling protein activity; |
◆ Recombinant Proteins | ||
CD19-3307H | Active Recombinant Human CD19 protein, Fc-tagged | +Inquiry |
CD19-07H | Active Recombinant Human CD19 Protein, Fc-tagged, Atto 488 conjugated | +Inquiry |
Cd19-3308M | Recombinant Mouse Cd19 protein, His-tagged | +Inquiry |
CD19-2948H | Recombinant Human CD19 protein, His-tagged, Site-Specific AF 647-Labeled | +Inquiry |
CD19-409H | Recombinant Human CD19 Protein, DDK/His-tagged | +Inquiry |
◆ Native Proteins | ||
CD19-59M | Active Recombinant Mouse CD19 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD19-2005HCL | Recombinant Human CD19 cell lysate | +Inquiry |
CD19-2164MCL | Recombinant Mouse CD19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD19 Products
Required fields are marked with *
My Review for All CD19 Products
Required fields are marked with *
0
Inquiry Basket