Recombinant Human CD19

Cat.No. : CD19-27864TH
Product Overview : Recombinant Human CD19 fragment, amino acids 98-187 with a proprietary N-terminal tag; molecular weight 35.53 kDa inclusive of tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD
Sequence Similarities : Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name CD19 CD19 molecule [ Homo sapiens ]
Official Symbol CD19
Synonyms CD19; CD19 molecule; CD19 antigen; B-lymphocyte antigen CD19;
Gene ID 930
mRNA Refseq NM_001178098
Protein Refseq NP_001171569
MIM 107265
Uniprot ID P15391
Chromosome Location 16p11.2
Pathway Adaptive Immune System, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem;
Function receptor signaling protein activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD19 Products

Required fields are marked with *

My Review for All CD19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon