Recombinant Human CD1D protein, His-tagged
Cat.No. : | CD1D-10920H |
Product Overview : | Recombinant Human CD1D protein(18-302 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-302 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTSM |
Gene Name | CD1D CD1d molecule [ Homo sapiens ] |
Official Symbol | CD1D |
Synonyms | CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d; R3G1; thymocyte antigen CD1D; CD1D antigen, d polypeptide; T-cell surface glycoprotein CD1d; differentiation antigen CD1-alpha-3; HMC class I antigen-like glycoprotein CD1D; R3; CD1A; MGC34622; |
Gene ID | 912 |
mRNA Refseq | NM_001766 |
Protein Refseq | NP_001757 |
MIM | 188410 |
UniProt ID | P15813 |
◆ Recombinant Proteins | ||
ABCA9-8144H | Recombinant Human ABCA9 protein, His & T7-tagged | +Inquiry |
ABCA9-1086M | Recombinant Mouse ABCA9 Protein | +Inquiry |
Abca9-8146R | Recombinant Rat Abca9 protein, His & T7-tagged | +Inquiry |
ABCA9-185M | Recombinant Mouse ABCA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Abca9-8145M | Recombinant Mouse Abca9 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCA9 Products
Required fields are marked with *
My Review for All ABCA9 Products
Required fields are marked with *
0
Inquiry Basket