Recombinant Human CD1D protein, His-tagged
| Cat.No. : | CD1D-10920H |
| Product Overview : | Recombinant Human CD1D protein(18-302 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | February 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 18-302 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | SAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTSM |
| Gene Name | CD1D CD1d molecule [ Homo sapiens ] |
| Official Symbol | CD1D |
| Synonyms | CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d; R3G1; thymocyte antigen CD1D; CD1D antigen, d polypeptide; T-cell surface glycoprotein CD1d; differentiation antigen CD1-alpha-3; HMC class I antigen-like glycoprotein CD1D; R3; CD1A; MGC34622; |
| Gene ID | 912 |
| mRNA Refseq | NM_001766 |
| Protein Refseq | NP_001757 |
| MIM | 188410 |
| UniProt ID | P15813 |
| ◆ Recombinant Proteins | ||
| CD1D-5279H | Recombinant Human CD1D Protein (Met1-Ser301), C-His tagged | +Inquiry |
| CD1D-64HF | Recombinant Full Length Human CD1D Protein | +Inquiry |
| CD1D-151H | Recombinant Human CD1D Protein, His-tagged | +Inquiry |
| CD1D-2188H | Recombinant Human CD1D, His tagged | +Inquiry |
| CD1D-231H | Recombinant Human CD1D Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD1D-2479HCL | Recombinant Human CD1D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD1D Products
Required fields are marked with *
My Review for All CD1D Products
Required fields are marked with *
