"CD200" Related Products

Expand
Expand
Expand

Recombinant Human CD200 Protein, GST-Tagged

Cat.No. : CD200-0742H
Product Overview : Human CD200 partial ORF (NP_005935, 34 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 35.75 kDa
AA Sequence : VVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CD200 CD200 molecule [ Homo sapiens ]
Official Symbol : CD200
Synonyms : CD200; CD200 molecule; antigen identified by monoclonal MRC OX 2, CD200 antigen, MOX1, MOX2; OX-2 membrane glycoprotein; MRC; OX 2; CD200 antigen; MRC OX-2 antigen; antigen identified by monoclonal MRC OX-2; MOX1; MOX2; OX-2;
Gene ID : 4345
mRNA Refseq : NM_001004196
Protein Refseq : NP_001004196
MIM : 155970
UniProt ID : P41217

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.