Recombinant Human CD200 Protein, GST-Tagged
Cat.No. : | CD200-0742H |
Product Overview : | Human CD200 partial ORF (NP_005935, 34 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 35.75 kDa |
AA Sequence : | VVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD200 CD200 molecule [ Homo sapiens ] |
Official Symbol | CD200 |
Synonyms | CD200; CD200 molecule; antigen identified by monoclonal MRC OX 2, CD200 antigen, MOX1, MOX2; OX-2 membrane glycoprotein; MRC; OX 2; CD200 antigen; MRC OX-2 antigen; antigen identified by monoclonal MRC OX-2; MOX1; MOX2; OX-2; |
Gene ID | 4345 |
mRNA Refseq | NM_001004196 |
Protein Refseq | NP_001004196 |
MIM | 155970 |
UniProt ID | P41217 |
◆ Recombinant Proteins | ||
CD200-1334H | Recombinant Human CD200 Protein (Gln31-Gly232), N-His tagged | +Inquiry |
Cd200-660R | Recombinant Rat Cd200 Protein, His&GST-tagged | +Inquiry |
CD200-164H | Active Recombinant Human CD200, Fc-tagged | +Inquiry |
CD200-051H | Active Recombinant Human CD200 protein, His/Avi-tagged, Biotinylated | +Inquiry |
CD200-029HB | Recombinant Human CD200 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD200-1041CCL | Recombinant Cynomolgus CD200 cell lysate | +Inquiry |
CD200-2707HCL | Recombinant Human CD200 cell lysate | +Inquiry |
CD200-2638MCL | Recombinant Mouse CD200 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD200 Products
Required fields are marked with *
My Review for All CD200 Products
Required fields are marked with *
0
Inquiry Basket