| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
CD22 (also known as siglec-2) is a member of the sialic acid-binding immunoglobulin-type lectin (Siglec) family of immunomodulatory receptors. CD22 can bind to its ligand α 2,6-linked sialic acid on different cells (trans interaction) as well as on the same cells (cis interaction). CD22 is predominantly expressed on B cells and functions as an inhibitory co-receptor for the B cell receptor (BCR). After BCR ligation, the tyrosine kinase Lyn is activated and phosphorylates two distal of the four ITIM motifs in the intracellular carboxy-terminal region of CD22, which then recruit tyrosine phosphatases, including SHP-1, to the plasma membrane, and in turn, they get tyrosine-phosphorylated and activated to damp the signaling pathways initiated by BCR ligation. CD22 has been actively pursued as a therapeutic target for autoimmune diseases. Due to almost exclusive expression on B cells, it is also actively pursued as a therapeutic target for multiple B cell malignancies. |
| Molecular Mass : |
~74 kDa |
| AA Sequence : |
DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR |
| Purity : |
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : |
For research use only, not for use in diagnostic procedure. |
| Storage : |
Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : |
≥0.5 mg/mL |
| Storage Buffer : |
PBS, 4M Urea, pH7.4 |