Recombinant Human CD22 protein, His-Avi-tagged, Biotinylated

Cat.No. : CD22-4343H
Product Overview : Recombinant Human CD22 protein(P20273)(20-687aa), fused with C-terminal His and Avi tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&His
Protein Length : 20-687aa
Tag : C-His-Avi
Conjugation/Label : Biotin
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 79.2 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR
Gene Name CD22 CD22 molecule [ Homo sapiens ]
Official Symbol CD22
Synonyms CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020;
Gene ID 933
mRNA Refseq NM_001185099
Protein Refseq NP_001172028
MIM 107266
UniProt ID P20273

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD22 Products

Required fields are marked with *

My Review for All CD22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon