Recombinant Human CD22 protein, His-Avi-tagged, Biotinylated
Cat.No. : | CD22-4343H |
Product Overview : | Recombinant Human CD22 protein(P20273)(20-687aa), fused with C-terminal His and Avi tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&His |
Protein Length : | 20-687aa |
Tag : | C-His-Avi |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 79.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR |
Gene Name | CD22 CD22 molecule [ Homo sapiens ] |
Official Symbol | CD22 |
Synonyms | CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020; |
Gene ID | 933 |
mRNA Refseq | NM_001185099 |
Protein Refseq | NP_001172028 |
MIM | 107266 |
UniProt ID | P20273 |
◆ Recombinant Proteins | ||
CD22-27297TH | Recombinant Human CD22 | +Inquiry |
CD22-561HAF647 | Active Recombinant Human CD22 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD22-8854CF | Recombinant Monkey CD22 Protein, Fc-tagged, FITC conjugated | +Inquiry |
CD22-0666H | Active Recombinant Human CD22 protein, His-tagged, FITC-Labeled | +Inquiry |
CD22-0662H | Recombinant Human CD22 protein, His-tagged, Alexa Fluor 488-Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD22-1956HCL | Recombinant Human CD22 cell lysate | +Inquiry |
CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD22 Products
Required fields are marked with *
My Review for All CD22 Products
Required fields are marked with *
0
Inquiry Basket