Recombinant Human CD226 Protein, GST-Tagged

Cat.No. : CD226-0750H
Product Overview : Human CD226 partial ORF (NP_006557, 21 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]
Molecular Mass : 37.51 kDa
AA Sequence : VLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD226 CD226 molecule [ Homo sapiens ]
Official Symbol CD226
Synonyms CD226; CD226 molecule; CD226 antigen; DNAM 1; DNAM1; PTA1; TLiSA1; adhesion glycoprotein; DNAX accessory molecule 1; DNAX accessory molecule-1; platelet and T cell activation antigen 1; T lineage-specific activation antigen 1 antigen; DNAM-1;
Gene ID 10666
mRNA Refseq NM_006566
Protein Refseq NP_006557
MIM 605397
UniProt ID Q15762

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD226 Products

Required fields are marked with *

My Review for All CD226 Products

Required fields are marked with *

0
cart-icon