Recombinant Human CD226 Protein, GST-Tagged

• Cat.No.: CD226-0750H
• Product Overview: Human CD226 partial ORF (NP_006557, 21 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]
• Molecular Mass: 37.51 kDa
• AA Sequence: VLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD226 CD226 molecule [ Homo sapiens ]
• Official Symbol: CD226
• Synonyms: CD226; CD226 molecule; CD226 antigen; DNAM 1; DNAM1; PTA1; TLiSA1; adhesion glycoprotein; DNAX accessory molecule 1; DNAX accessory molecule-1; platelet and T cell activation antigen 1; T lineage-specific activation antigen 1 antigen; DNAM-1
• Gene ID: 10666
• mRNA Refseq: NM_006566
• Protein Refseq: NP_006557
• MIM: 605397
• UniProt ID: Q15762