Recombinant Human CD226 protein, T7/His-tagged
Cat.No. : | CD226-139H |
Product Overview : | Recombinant human CD226 extracellular domain cDNA (19 - 254 aa, derived from BC074787) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 19-254 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSP THGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVS DSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVA |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used as coating matrix protein or as soluble receptor for in vitro lymphocytes differentiation or activation regulations study.2. May be used for protein-protein interaction assay development.3. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | CD226 CD226 molecule [ Homo sapiens ] |
Official Symbol | CD226 |
Synonyms | CD226; CD226 molecule; CD226 antigen; DNAM 1; DNAM1; PTA1; TLiSA1; adhesion glycoprotein; DNAX accessory molecule 1; DNAX accessory molecule-1; platelet and T cell activation antigen 1; T lineage-specific activation antigen 1 antigen; DNAM-1; |
Gene ID | 10666 |
mRNA Refseq | NM_006566 |
Protein Refseq | NP_006557 |
MIM | 605397 |
UniProt ID | Q15762 |
Chromosome Location | 18q22.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem; |
Function | cell adhesion molecule binding; integrin binding; protein binding; protein kinase binding; receptor activity; |
◆ Recombinant Proteins | ||
CD226-634HP | Recombinant Human CD226 protein, Fc-His-tagged, R-PE labeled | +Inquiry |
CD226-0750H | Recombinant Human CD226 Protein, GST-Tagged | +Inquiry |
Cd226-8794RA | Recombinant Rat Cd226 protein, Fc-tagged, APC labeled | +Inquiry |
CD226-248CAF647 | Active Recombinant Monkey CD226 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Cd226-8794RF | Recombinant Rat Cd226 Protein, Fc-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD226-2645HCL | Recombinant Human CD226 cell lysate | +Inquiry |
CD226-2800MCL | Recombinant Mouse CD226 cell lysate | +Inquiry |
CD226-1173RCL | Recombinant Rat CD226 cell lysate | +Inquiry |
CD226-1167CCL | Recombinant Cynomolgus CD226 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD226 Products
Required fields are marked with *
My Review for All CD226 Products
Required fields are marked with *