Recombinant Human CD247
| Cat.No. : | CD247-27869TH |
| Product Overview : | Recombinant full length protein of Human CD3 zeta with proprietary tag; Predicted MWt 43.76 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 164 amino acids |
| Description : | The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Molecular Weight : | 43.760kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR |
| Sequence Similarities : | Belongs to the CD3Z/FCER1G family.Contains 3 ITAM domains. |
| Gene Name | CD247 CD247 molecule [ Homo sapiens ] |
| Official Symbol | CD247 |
| Synonyms | CD247; CD247 molecule; CD3Z, CD3z antigen, zeta polypeptide (TiT3 complex) , CD247 antigen; T-cell surface glycoprotein CD3 zeta chain; CD3H; CD3Q; |
| Gene ID | 919 |
| mRNA Refseq | NM_000734 |
| Protein Refseq | NP_000725 |
| MIM | 186780 |
| Uniprot ID | P20963 |
| Chromosome Location | 1q22-q25 |
| Pathway | Adaptive Immune System, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; |
| Function | identical protein binding; protein binding; protein homodimerization activity; receptor activity; transmembrane signaling receptor activity; |
| ◆ Recombinant Proteins | ||
| Cd247-665M | Recombinant Mouse Cd247 Protein, His-tagged | +Inquiry |
| CD247-7091C | Recombinant Chicken CD247 | +Inquiry |
| CD247-222H | Recombinant Human CD247 Protein, His-tagged | +Inquiry |
| RFL24008HF | Recombinant Full Length Human T-Cell Surface Glycoprotein Cd3 Zeta Chain(Cd247) Protein, His-Tagged | +Inquiry |
| Cd247-840M | Recombinant Mouse Cd247 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD247-7679HCL | Recombinant Human CD247 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD247 Products
Required fields are marked with *
My Review for All CD247 Products
Required fields are marked with *



