Recombinant Human CD247 protein, His-tagged
Cat.No. : | CD247-7091H |
Product Overview : | Recombinant Human CD247 (Met1~Leu160 (Accession # P20963)) protein is produced by E. coli expression system. This protein is fused with a His tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Met1-Leu160 |
Form : | PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. |
Molecular Mass : | Predicted Molecular Mass: 19.9 kDa |
AA Sequence : | MGHHHHHHSGSEFMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMA EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQAL |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 95% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Reconstitution : | Reconstitute in PBS or others. |
Gene Name | CD247 CD247 molecule [ Homo sapiens ] |
Official Symbol | CD247 |
Synonyms | CD247; CD247 molecule; CD3H; CD3Q; CD3zeta chain; T3Z; CD3Z; TCRZ; CD3-ZETA; |
Gene ID | 919 |
mRNA Refseq | NM_000734 |
Protein Refseq | NP_000725 |
MIM | 186780 |
UniProt ID | P20963 |
◆ Recombinant Proteins | ||
CD247-0944H | Recombinant Human CD247 Protein (Arg52-Arg164), N-GST tagged | +Inquiry |
CD247-2362H | Recombinant Human CD247 protein(Arg52-Arg164) | +Inquiry |
CD247-7090H | Recombinant Human CD247, His-tagged | +Inquiry |
CD247-0757H | Recombinant Human CD247 Protein, GST-Tagged | +Inquiry |
CD247-222H | Recombinant Human CD247 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD247-7679HCL | Recombinant Human CD247 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD247 Products
Required fields are marked with *
My Review for All CD247 Products
Required fields are marked with *