Recombinant Human CD248 protein, His-tagged
Cat.No. : | CD248-230H |
Product Overview : | Recombinant Human CD248 protein(NP_065137)(21-401 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-401 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | WAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQASQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGILWMEPT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CD248 CD248 molecule, endosialin [ Homo sapiens ] |
Official Symbol | CD248 |
Synonyms | CD248; CD248 molecule, endosialin; CD164 sialomucin like 1 , CD164L1, CD248 antigen, endosialin; endosialin; TEM1; tumor endothelial marker 1; 2610111G01Rik; CD164 sialomucin-like 1; CD248 antigen, endosialin; CD164L1; MGC119478; MGC119479; |
Gene ID | 57124 |
mRNA Refseq | NM_020404 |
Protein Refseq | NP_065137 |
MIM | 606064 |
UniProt ID | Q9HCU0 |
◆ Recombinant Proteins | ||
CD248-557R | Recombinant Rhesus Macaque CD248 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD248-3063M | Recombinant Mouse CD248 Protein | +Inquiry |
Cd248-01M | Recombinant Mouse Cd248 Protein, His-tagged, Biotinylated | +Inquiry |
CD248-1655C | Recombinant Canine CD248 protein, His-tagged | +Inquiry |
CD248-1630R | Recombinant Rhesus Monkey CD248 Protein, hIgG4-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD248-315HCL | Recombinant Human CD248 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD248 Products
Required fields are marked with *
My Review for All CD248 Products
Required fields are marked with *