Recombinant Human CD27

• Cat.No.: CD27-26925TH
• Product Overview: Recombinant full length Human CD27 with N terminal proprietary tag; Predicted MWt 54.34 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 260 amino acids
• Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.
• Molecular Weight: 54.340kDa inclusive of tags
• Tissue specificity: Found in most T-lymphocytes.
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCC QMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPH CESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHM QTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMF LVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREE EGSTIPIQEDYRKPEPACSP
• Sequence Similarities: Contains 3 TNFR-Cys repeats.

Gene Information

• Gene Name: CD27 CD27 molecule [ Homo sapiens ]
• Official Symbol: CD27
• Synonyms: CD27; CD27 molecule; TNFRSF7, tumor necrosis factor receptor superfamily, member 7; CD27 antigen; S152; Tp55
• Gene ID: 939
• mRNA Refseq: NM_001242
• Protein Refseq: NP_001233
• MIM: 186711
• Uniprot ID: P26842
• Chromosome Location: 12p13
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem
• Function: cysteine-type endopeptidase inhibitor activity involved in apoptotic process; protein binding; receptor activity; transmembrane signaling receptor activity