Recombinant Human CD27
Cat.No. : | CD27-26925TH |
Product Overview : | Recombinant full length Human CD27 with N terminal proprietary tag; Predicted MWt 54.34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 260 amino acids |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor. |
Molecular Weight : | 54.340kDa inclusive of tags |
Tissue specificity : | Found in most T-lymphocytes. |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCC QMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPH CESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHM QTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMF LVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREE EGSTIPIQEDYRKPEPACSP |
Sequence Similarities : | Contains 3 TNFR-Cys repeats. |
Gene Name | CD27 CD27 molecule [ Homo sapiens ] |
Official Symbol | CD27 |
Synonyms | CD27; CD27 molecule; TNFRSF7, tumor necrosis factor receptor superfamily, member 7; CD27 antigen; S152; Tp55; |
Gene ID | 939 |
mRNA Refseq | NM_001242 |
Protein Refseq | NP_001233 |
MIM | 186711 |
Uniprot ID | P26842 |
Chromosome Location | 12p13 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
Function | cysteine-type endopeptidase inhibitor activity involved in apoptotic process; protein binding; receptor activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
Cd27-3273MAF647 | Recombinant Mouse Cd27 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Cd27-3273MAF488 | Recombinant Mouse Cd27 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Cd27-840MAF488 | Active Recombinant Mouse Cd27 Protein, His/Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD27-888H | Recombinant Human CD27 Protein, Fc/His-tagged | +Inquiry |
CD27-56H | Recombinant Human CD27 Molecule, Fc-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD27-001HCL | Recombinant Human CD27 cell lysate | +Inquiry |
CD27-2415MCL | Recombinant Mouse CD27 cell lysate | +Inquiry |
CD27-1383HCL | Recombinant Human CD27 cell lysate | +Inquiry |
CD27-1156CCL | Recombinant Cynomolgus CD27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD27 Products
Required fields are marked with *
My Review for All CD27 Products
Required fields are marked with *