Recombinant Human CD27
| Cat.No. : | CD27-26925TH |
| Product Overview : | Recombinant full length Human CD27 with N terminal proprietary tag; Predicted MWt 54.34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 260 amino acids |
| Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor. |
| Molecular Weight : | 54.340kDa inclusive of tags |
| Tissue specificity : | Found in most T-lymphocytes. |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCC QMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPH CESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHM QTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMF LVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREE EGSTIPIQEDYRKPEPACSP |
| Sequence Similarities : | Contains 3 TNFR-Cys repeats. |
| Gene Name | CD27 CD27 molecule [ Homo sapiens ] |
| Official Symbol | CD27 |
| Synonyms | CD27; CD27 molecule; TNFRSF7, tumor necrosis factor receptor superfamily, member 7; CD27 antigen; S152; Tp55; |
| Gene ID | 939 |
| mRNA Refseq | NM_001242 |
| Protein Refseq | NP_001233 |
| MIM | 186711 |
| Uniprot ID | P26842 |
| Chromosome Location | 12p13 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
| Function | cysteine-type endopeptidase inhibitor activity involved in apoptotic process; protein binding; receptor activity; transmembrane signaling receptor activity; |
| ◆ Recombinant Proteins | ||
| CD27-572H | Recombinant Human CD27 protein, His-tagged | +Inquiry |
| Cd27-365M | Recombinant Mouse Cd27 Protein, His&GST-tagged | +Inquiry |
| Cd27-840M | Active Recombinant Mouse Cd27 Protein, His & Fc-tagged | +Inquiry |
| RFL31933HF | Recombinant Full Length Human Cd27 Antigen(Cd27) Protein, His-Tagged | +Inquiry |
| CD27-357M | Recombinant Mouse CD27 protein, Mouse IgG2a Fc-tagged, low endotoxin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD27-1383HCL | Recombinant Human CD27 cell lysate | +Inquiry |
| CD27-001HCL | Recombinant Human CD27 cell lysate | +Inquiry |
| CD27-1156CCL | Recombinant Cynomolgus CD27 cell lysate | +Inquiry |
| CD27-2415MCL | Recombinant Mouse CD27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD27 Products
Required fields are marked with *
My Review for All CD27 Products
Required fields are marked with *



