Recombinant Human CD274 protein, His-tagged, biotinylated

Cat.No.: CD274-785H
Product Overview: Recombinant Human CD274(Phe19 - Arg238), fused with His tag at C-terminal was expressed in HEK293, Biotinylated, it contains 4 potential sites for N-linked glycosylation.
Source: HEK293
Species: Human
Tag: His
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Binds to its receptor PD-1 extracellular domain proteins and PD-1 molecule on cell surface with low affinity (KD in μM range) and anti-PD-L1 monoclonal antibody with high affinity(KD < 1 nM) as measured by ELISA.
Molecular Mass: Calculated molecular mass 26.5kDa; estimated by SDS-PAGE under reducing condition ~35 kDa with higher molecular mass smear resembling different glycosylation states.
AA Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLS LGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIW TSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERSTG HHHHHHHH
Endotoxin: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Purity: >95% judged by SDS-PAGE under reducing condition
Gene Name: CD274 CD274 molecule [ Homo sapiens ]
Official Symbol: CD274
Synonyms: CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296;
Gene ID: 29126
mRNA Refseq: NM_014143
Protein Refseq: NP_054862
MIM: 605402
UniProt ID: Q9NZQ7
Chromosome Location: 9p24.1
Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem;
Function: protein binding; protein tyrosine phosphatase activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.