Recombinant Human CD28 Protein

• Cat.No.: CD28-0772H
• Product Overview: Human CD28 full-length ORF (AAH93698.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]
• Form: Liquid
• Molecular Mass: 25.1 kDa
• AA Sequence: MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CD28 CD28 molecule [ Homo sapiens ]
• Official Symbol: CD28
• Synonyms: CD28; CD28 molecule; CD28 antigen (Tp44); T-cell-specific surface glycoprotein CD28; T cell specific surface glycoprotein; CD28 antigen; Tp44; MGC138290
• Gene ID: 940
• mRNA Refseq: NM_001243077
• Protein Refseq: NP_001230006
• MIM: 186760
• UniProt ID: P10747