Recombinant Human CD2BP2 protein, GST-tagged
Cat.No. : | CD2BP2-7444H |
Product Overview : | Recombinant Human CD2BP2 protein(250-341 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 250-341 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CD2BP2 CD2 (cytoplasmic tail) binding protein 2 [ Homo sapiens ] |
Official Symbol | CD2BP2 |
Synonyms | CD2BP2; CD2 (cytoplasmic tail) binding protein 2; CD2 antigen (cytoplasmic tail) binding protein 2; CD2 antigen cytoplasmic tail-binding protein 2; LIN1; PPP1R59; protein phosphatase 1; regulatory subunit 59; Snu40; U5 snRNP 52K protein; CD2 cytoplasmic domain-binding protein 2; protein phosphatase 1, regulatory subunit 59; FWP010; U5-52K; |
Gene ID | 10421 |
mRNA Refseq | NM_001243646 |
Protein Refseq | NP_001230575 |
MIM | 604470 |
UniProt ID | O95400 |
◆ Recombinant Proteins | ||
CD2BP2-0775H | Recombinant Human CD2BP2 Protein, GST-Tagged | +Inquiry |
CD2BP2-3070M | Recombinant Mouse CD2BP2 Protein | +Inquiry |
CD2BP2-561R | Recombinant Rhesus Macaque CD2BP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD2BP2-1450M | Recombinant Mouse CD2BP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD2BP2-11196Z | Recombinant Zebrafish CD2BP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD2BP2-175HCL | Recombinant Human CD2BP2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD2BP2 Products
Required fields are marked with *
My Review for All CD2BP2 Products
Required fields are marked with *