Recombinant Human CD300c protein, T7/His-tagged
Cat.No. : | CD300c-73H |
Product Overview : | Recombinant human CD300c cDNA (21 – 183 aa, derived from BC022279) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 21-183 a.a. |
Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCD KIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASS PQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro non-glycosylated CD300c protein mediated TH1 and TH17 cell function regulation with this protein as either coating matrix protein or soluble factor.2. May be used for CD300c protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As potential biomarker protein for differentiating patients with ulcerative colitis in Crohn"s disease from non-inflammatory diarrhea.5. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CD300C CD300c molecule [ Homo sapiens ] |
Official Symbol | CD300c |
Synonyms | CD300C; CD300c molecule; CD300c antigen; CMRF35-like molecule 6; CMRF 35A; CMRF35; CMRF35A; IGSF16; LIR; CMRF35 antigen; CD300 antigen-like family member C; immunoglobulin superfamily member 16; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35A leuko |
Gene ID | 10871 |
mRNA Refseq | NM_006678 |
Protein Refseq | NP_006669 |
MIM | 606786 |
UniProt ID | Q08708 |
Chromosome Location | 17q25.2 |
Function | receptor activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
CD300C-1696R | Recombinant Rhesus Monkey CD300C Protein, hIgG1-tagged | +Inquiry |
CD300C-01H | Recombinant Human CD300C Protein, His-Tagged | +Inquiry |
CD300C-1697R | Recombinant Rhesus Monkey CD300C Protein, hIgG4-tagged | +Inquiry |
CD300C-13M | Recombinant Mouse CD300C Chimera Protein, N-Fc-tagged | +Inquiry |
CD300C-1695R | Recombinant Rhesus Monkey CD300C Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD300C-2096HCL | Recombinant Human CD300C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD300c Products
Required fields are marked with *
My Review for All CD300c Products
Required fields are marked with *