Recombinant Human CD300LB Protein
| Cat.No. : | CD300LB-0783H |
| Product Overview : | Human CD300LB full-length ORF (NP_777552.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells (Martinez-Barriocanal and Sayos, 2006 [PubMed 16920917]).[supplied by OMIM, Mar 2008] |
| Form : | Liquid |
| Molecular Mass : | 27 kDa |
| AA Sequence : | MCRRCKPELGQNFQSASGICICHWLQIRRTRSREGRAMWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | CD300LB CD300 molecule-like family member b [ Homo sapiens ] |
| Official Symbol | CD300LB |
| Synonyms | CD_antigen=CD300b; CD300 antigen-like family member B; CD300 molecule-like family member b; CD300B; CLM 7; CLM7; CLM7_HUMAN; CMRF35 A2; CMRF35-like molecule 7; CMRF35A2; Immune receptor expressed on myeloid cells 3; IREM 3; IREM3; Leukocyte mono-Ig-like receptor 5; LMIR5; TREM 5; TREM5; Triggering receptor expressed on myeloid cells 5; UNQ2530/PRO6029; |
| Gene ID | 124599 |
| mRNA Refseq | NM_174892 |
| Protein Refseq | NP_777552 |
| MIM | 610705 |
| UniProt ID | A8K4G0 |
| ◆ Recombinant Proteins | ||
| CD300LB-0783H | Recombinant Human CD300LB Protein | +Inquiry |
| CD300LB-0784H | Recombinant Human CD300LB Protein, GST-Tagged | +Inquiry |
| CD300LB-1355H | Recombinant Human CD300LB Protein (18-151 aa), His-tagged | +Inquiry |
| CD300LB-10941H | Recombinant Human CD300LB, GST-tagged | +Inquiry |
| CD300LB-1258H | Recombinant Human CD300LB protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD300LB-176HCL | Recombinant Human CD300LB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD300LB Products
Required fields are marked with *
My Review for All CD300LB Products
Required fields are marked with *



