Recombinant Human CD300LB Protein (18-151 aa), His-tagged

Cat.No. : CD300LB-1355H
Product Overview : Recombinant Human CD300LB Protein (18-151 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 18-151 aa
Description : Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 17.2 kDa
AA Sequence : IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name CD300LB CD300 molecule-like family member b [ Homo sapiens ]
Official Symbol CD300LB
Synonyms CD300B; CLM 7; CLM7; CLM7_HUMAN; CMRF35 A2; IREM 3; IREM3; LMIR5; TREM 5; TREM5;
Gene ID 124599
mRNA Refseq NM_174892.2
Protein Refseq NP_777552.2
MIM 610705
UniProt ID A8K4G0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD300LB Products

Required fields are marked with *

My Review for All CD300LB Products

Required fields are marked with *

0
cart-icon