Recombinant Human CD302 Protein, C-His-tagged

Cat.No. : CD302-212H
Product Overview : Recombinant Human CD302 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CD302,potential multifunctional C-type lectin receptor that may play roles in endocytosis and phagocytosis as well as in cell adhesion and migration.
Molecular Mass : ~17 kDa
AA Sequence : DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNH
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD302 CD302 molecule [ Homo sapiens (human) ]
Official Symbol CD302
Synonyms DCL1; DCL-1; BIMLEC; CLEC13A
Gene ID 9936
mRNA Refseq NM_014880
Protein Refseq NP_055695
MIM 612246
UniProt ID Q8IX05

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD302 Products

Required fields are marked with *

My Review for All CD302 Products

Required fields are marked with *

0
cart-icon