Recombinant Human CD302 Protein, C-His-tagged

• Cat.No.: CD302-212H
• Product Overview: Recombinant Human CD302 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: CD302，potential multifunctional C-type lectin receptor that may play roles in endocytosis and phagocytosis as well as in cell adhesion and migration.
• Molecular Mass: ~17 kDa
• AA Sequence: DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNH
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD302 CD302 molecule [ Homo sapiens (human) ]
• Official Symbol: CD302
• Synonyms: DCL1; DCL-1; BIMLEC; CLEC13A
• Gene ID: 9936
• mRNA Refseq: NM_014880
• Protein Refseq: NP_055695
• MIM: 612246
• UniProt ID: Q8IX05