Recombinant Human CD302 protein, His-tagged
| Cat.No. : | CD302-3211H |
| Product Overview : | Recombinant Human CD302 protein(63 - 165 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 21, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 63 - 165 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CD302 CD302 molecule [ Homo sapiens ] |
| Official Symbol | CD302 |
| Synonyms | DCL1; DCL-1; BIMLEC; CLEC13A |
| Gene ID | 9936 |
| mRNA Refseq | NM_014880.4 |
| Protein Refseq | NP_055695.2 |
| MIM | 612246 |
| UniProt ID | Q8IX05 |
| ◆ Recombinant Proteins | ||
| CD302-1701R | Recombinant Rhesus Monkey CD302 Protein, hIgG4-tagged | +Inquiry |
| CD302-3157HF | Recombinant Full Length Human CD302 Protein | +Inquiry |
| CD302-151H | Recombinant Human CD302 Protein, His-tagged | +Inquiry |
| CD302-1064H | Recombinant Human CD302 Protein (Met63-Asp232), N-His tagged | +Inquiry |
| RFL5232BF | Recombinant Full Length Bovine Cd302 Antigen(Cd302) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD302-1747MCL | Recombinant Mouse CD302 cell lysate | +Inquiry |
| CD302-1172RCL | Recombinant Rat CD302 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD302 Products
Required fields are marked with *
My Review for All CD302 Products
Required fields are marked with *
