Recombinant Human CD302 protein, His-tagged
Cat.No. : | CD302-3211H |
Product Overview : | Recombinant Human CD302 protein(63 - 165 aa), fused to His tag, was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 63 - 165 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CD302 CD302 molecule [ Homo sapiens ] |
Official Symbol | CD302 |
Synonyms | DCL1; DCL-1; BIMLEC; CLEC13A |
Gene ID | 9936 |
mRNA Refseq | NM_014880.4 |
Protein Refseq | NP_055695.2 |
MIM | 612246 |
UniProt ID | Q8IX05 |
◆ Recombinant Proteins | ||
CD302-5379H | Recombinant Human CD302 Protein (Met1-His168), C-His tagged | +Inquiry |
CD302-6253H | Recombinant Human CD302 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD302-212H | Recombinant Human CD302 Protein, C-His-tagged | +Inquiry |
Cd302-8804R | Recombinant Rat Cd302 protein, His-tagged | +Inquiry |
CD302-3211H | Recombinant Human CD302 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD302-1172RCL | Recombinant Rat CD302 cell lysate | +Inquiry |
CD302-1747MCL | Recombinant Mouse CD302 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD302 Products
Required fields are marked with *
My Review for All CD302 Products
Required fields are marked with *
0
Inquiry Basket