Species : |
Human |
Source : |
HEK293 |
Tag : |
Fc |
Description : |
This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : |
Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH 8.0 |
Molecular Mass : |
47.3kD |
AA Sequence : |
SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVVDHHHHHH |
Endotoxin : |
Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : |
>95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |