Recombinant Human CD320 Protein, Fc-tagged

• Cat.No.: CD320-043H
• Product Overview: Recombinant Human CD320 fused with Fc tag at C-termina was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Description: This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH 8.0
• Molecular Mass: 47.3kD
• AA Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: CD320 CD320 molecule [ Homo sapiens (human) ]
• Official Symbol: CD320
• Synonyms: 8D6; 8D6A; TCBLR; CD320
• Gene ID: 51293
• mRNA Refseq: NM_001165895.1
• Protein Refseq: NP_057663
• MIM: 606475
• UniProt ID: F5H6D3