Recombinant Human CD33 Protein, Fc/His-tagged

• Cat.No.: CD33-833H
• Product Overview: Recombinant Human CD33, transcript variant 1, fused with Fc/His tag at C-terminal was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&His
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 2mM EDTA, pH 7.2
• Molecular Mass: 55.01kD
• AA Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHTSDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS?NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: CD33 CD33 molecule [ Homo sapiens ]
• Official Symbol: CD33
• Synonyms: CD33; CD33 molecule; CD33 antigen (gp67); myeloid cell surface antigen CD33; FLJ00391; p67; sialic acid binding Ig like lectin 3; SIGLEC 3; SIGLEC3; gp67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC-3
• Gene ID: 945
• mRNA Refseq: NM_001082618
• Protein Refseq: NP_001076087
• MIM: 159590
• UniProt ID: P20138