Recombinant Human CD33 Protein, Fc/His-tagged
Cat.No. : | CD33-833H |
Product Overview : | Recombinant Human CD33, transcript variant 1, fused with Fc/His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 2mM EDTA, pH 7.2 |
Molecular Mass : | 55.01kD |
AA Sequence : | DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHTSDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS?NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | CD33 CD33 molecule [ Homo sapiens ] |
Official Symbol | CD33 |
Synonyms | CD33; CD33 molecule; CD33 antigen (gp67); myeloid cell surface antigen CD33; FLJ00391; p67; sialic acid binding Ig like lectin 3; SIGLEC 3; SIGLEC3; gp67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC-3; |
Gene ID | 945 |
mRNA Refseq | NM_001082618 |
Protein Refseq | NP_001076087 |
MIM | 159590 |
UniProt ID | P20138 |
◆ Recombinant Proteins | ||
Cd33-5169MF | Recombinant Mouse Cd33 Protein, His-tagged, FITC conjugated | +Inquiry |
CD33-4673H | Active Recombinant Human CD33 Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
CD33-0705R | Active Recombinant Rat CD33 protein, His-tagged | +Inquiry |
CD33-234HB | Recombinant Human CD33 protein, His-tagged, Biotinylated | +Inquiry |
CD33-0712H | Recombinant Human CD33 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD33-978HCL | Recombinant Human CD33 cell lysate | +Inquiry |
CD33-1808MCL | Recombinant Mouse CD33 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD33 Products
Required fields are marked with *
My Review for All CD33 Products
Required fields are marked with *
0
Inquiry Basket