Recombinant Human CD33 Protein, Fc/His-tagged
| Cat.No. : | CD33-833H |
| Product Overview : | Recombinant Human CD33, transcript variant 1, fused with Fc/His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&His |
| Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 2mM EDTA, pH 7.2 |
| Molecular Mass : | 55.01kD |
| AA Sequence : | DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHTSDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS?NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKVDHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | CD33 CD33 molecule [ Homo sapiens ] |
| Official Symbol | CD33 |
| Synonyms | CD33; CD33 molecule; CD33 antigen (gp67); myeloid cell surface antigen CD33; FLJ00391; p67; sialic acid binding Ig like lectin 3; SIGLEC 3; SIGLEC3; gp67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC-3; |
| Gene ID | 945 |
| mRNA Refseq | NM_001082618 |
| Protein Refseq | NP_001076087 |
| MIM | 159590 |
| UniProt ID | P20138 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD33 Products
Required fields are marked with *
My Review for All CD33 Products
Required fields are marked with *



