Recombinant Human CD33 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated
| Cat.No. : | CD33-833HAF647 |
| Product Overview : | Alexa Fluor 647 conjugated recombinant human CD33, transcript variant 1, fused with Fc/His tag at C-terminal was expressed in HEK293 cells. |
| Availability | January 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&His |
| Form : | Lyophilized |
| Molecular Mass : | 55.01 kDa |
| AA Sequence : | DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHTSDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKVDHHHHHH |
| Endotoxin : | < 0.1 ng/ μg of protein (< 1 EU/ μg). |
| Purity : | > 95 % as determined by SDS-PAGE and Coomassie blue staining |
| Characteristic : | Disulfide-linked homodimer Labeled with Alexa Fluor 647 via amines Excitation = 650 nm Emission = 668 nm |
| Storage Buffer : | Lyophilized from a 0.2 μM filtered solution of 20 mM PB, 150 mM NaCl, 2 mM EDTA, pH 7.2 |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Conjugation : | Alexa Fluor 647 |
| Gene Name | CD33 CD33 molecule [ Homo sapiens ] |
| Official Symbol | CD33 |
| Synonyms | CD33; CD33 molecule; CD33 antigen (gp67); myeloid cell surface antigen CD33; FLJ00391; p67; sialic acid binding Ig like lectin 3; SIGLEC 3; SIGLEC3; gp67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC-3; |
| Gene ID | 945 |
| mRNA Refseq | NM_001082618 |
| Protein Refseq | NP_001076087 |
| MIM | 159590 |
| UniProt ID | P20138 |
| ◆ Recombinant Proteins | ||
| CD33-234H | Recombinant Human CD33, His tagged | +Inquiry |
| CD33-205H | Recombinant Human CD33 Protein, His-tagged | +Inquiry |
| CD33-313HAF488 | Recombinant Human CD33 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| CD33-833HA | Recombinant Human CD33 protein, Fc/His-tagged, APC labeled | +Inquiry |
| CD33-0710H | Active Recombinant Human CD33 protein, Fc-tagged, FITC-Labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD33-1808MCL | Recombinant Mouse CD33 cell lysate | +Inquiry |
| CD33-978HCL | Recombinant Human CD33 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD33 Products
Required fields are marked with *
My Review for All CD33 Products
Required fields are marked with *
