Recombinant Human CD33 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated

Cat.No. : CD33-833HAF647
Product Overview : Alexa Fluor 647 conjugated recombinant human CD33, transcript variant 1, fused with Fc/His tag at C-terminal was expressed in HEK293 cells.
Availability June 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Form : Lyophilized
Molecular Mass : 55.01 kDa
AA Sequence : DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHTSDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKVDHHHHHH
Endotoxin : < 0.1 ng/ μg of protein (< 1 EU/ μg).
Purity : > 95 % as determined by SDS-PAGE and Coomassie blue staining
Characteristic : Disulfide-linked homodimer
Labeled with Alexa Fluor 647 via amines
Excitation = 650 nm
Emission = 668 nm
Storage Buffer : Lyophilized from a 0.2 μM filtered solution of 20 mM PB, 150 mM NaCl, 2 mM EDTA, pH 7.2
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name CD33 CD33 molecule [ Homo sapiens ]
Official Symbol CD33
Synonyms CD33; CD33 molecule; CD33 antigen (gp67); myeloid cell surface antigen CD33; FLJ00391; p67; sialic acid binding Ig like lectin 3; SIGLEC 3; SIGLEC3; gp67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC-3;
Gene ID 945
mRNA Refseq NM_001082618
Protein Refseq NP_001076087
MIM 159590
UniProt ID P20138

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD33 Products

Required fields are marked with *

My Review for All CD33 Products

Required fields are marked with *

0
cart-icon