Recombinant Human CD34 protein(81-220 aa), C-His-tagged
| Cat.No. : | CD34-2710H |
| Product Overview : | Recombinant Human CD34 protein(P28906)(81-220 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 81-220 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | EATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQA |
| Gene Name | CD34 CD34 molecule [ Homo sapiens ] |
| Official Symbol | CD34 |
| Synonyms | CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34; |
| Gene ID | 947 |
| mRNA Refseq | NM_001025109 |
| Protein Refseq | NP_001020280 |
| MIM | 142230 |
| UniProt ID | P28906 |
| ◆ Recombinant Proteins | ||
| Cd34-3313M | Recombinant Mouse Cd34 protein(Met1-Thr287), His-tagged | +Inquiry |
| CD34-7520H | Recombinant Human CD34, His-tagged | +Inquiry |
| CD34-228H | Recombinant Human CD34 | +Inquiry |
| CD34-651H | Recombinant Human CD34 protein, hFc-tagged | +Inquiry |
| CD34-3650H | Recombinant Human CD34 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD34-2232MCL | Recombinant Mouse CD34 cell lysate | +Inquiry |
| CD34-1408RCL | Recombinant Rat CD34 cell lysate | +Inquiry |
| CD34-3047HCL | Recombinant Human CD34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD34 Products
Required fields are marked with *
My Review for All CD34 Products
Required fields are marked with *
