Recombinant Human CD36, His-tagged
Cat.No. : | CD36-27868TH |
Product Overview : | Recombinant full length Human CD36 (amino acids 1-472) with a N terminal His tag; predicted MWt 77.99 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Protein length : | 472 amino acids |
Conjugation : | HIS |
Molecular Weight : | 77.990kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKK QVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNS SNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNS LINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGL FYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKII SKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPID GLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPS EKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTG KINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK |
Sequence Similarities : | Belongs to the CD36 family. |
Gene Name : | CD36 CD36 molecule (thrombospondin receptor) [ Homo sapiens ] |
Official Symbol : | CD36 |
Synonyms : | CD36; CD36 molecule (thrombospondin receptor); CD36 antigen (collagen type I receptor, thrombospondin receptor); platelet glycoprotein 4; FAT; GP3B; GP4; GPIV; SCARB3; |
Gene ID : | 948 |
mRNA Refseq : | NM_000072 |
Protein Refseq : | NP_000063 |
MIM : | 173510 |
Uniprot ID : | P16671 |
Chromosome Location : | 7q11.2 |
Pathway : | Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Antigen processing-Cross presentation, organism-specific biosystem; Class I MHC mediated antigen processing & |
Function : | Gram-negative bacterial cell surface binding; Gram-positive bacterial cell surface binding; high-density lipoprotein particle binding; lipid binding; lipoprotein particle binding; |
Products Types
◆ Recombinant Protein | ||
Cd36-834M | Recombinant Mouse Cd36 Protein, MYC/DDK-tagged | +Inquiry |
CD36-3084H | Recombinant Human CD36 Protein, MYC/DDK-tagged | +Inquiry |
CD36-3184H | Recombinant Human CD36 protein(Gly30-Asn439), His-tagged | +Inquiry |
CD36-0794H | Recombinant Human CD36 Protein | +Inquiry |
Cd36-3322M | Recombinant Mouse Cd36 protein(Gly30-Lys439), His&hFc-tagged | +Inquiry |
◆ Lysates | ||
CD36-1109CCL | Recombinant Cynomolgus CD36 cell lysate | +Inquiry |
CD36-2400MCL | Recombinant Mouse CD36 cell lysate | +Inquiry |
CD36-2539HCL | Recombinant Human CD36 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Customer Reviews (3)
Write a reviewDependable protein purification, consistently high-quality results.
Great antibody validation, enhances our immunoprecipitation experiments.
Swift protein expression optimization, invaluable for our research efficiency.
Q&As (7)
Ask a questionCD36 is involved in inflammation and immune responses, potentially exacerbating chronic inflammatory conditions.
Variations in CD36 function can influence the risk of obesity and associated health issues like metabolic syndrome.
CD36 modulates cell signaling related to energy utilization and storage, impacting metabolic health.
CD36 affects the development of metabolic disorders by influencing lipid metabolism and insulin sensitivity.
CD36 aids in taste perception, particularly in detecting and responding to dietary fats.
CD36 is implicated in cardiovascular diseases, contributing to the formation of atherosclerotic plaques.
CD36 facilitates the uptake and metabolism of fatty acids in cells, playing a critical role in lipid processing.
Ask a Question for All CD36 Products
Required fields are marked with *
My Review for All CD36 Products
Required fields are marked with *
Inquiry Basket