Recombinant Human CD36 Protein, His-tagged
Cat.No. : | CD36-153H |
Product Overview : | Recombinant human CD36 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 472 |
Description : | The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 47.5 kDa |
AA Sequence : | MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD36 CD36 molecule (thrombospondin receptor) [ Homo sapiens (human) ] |
Official Symbol | CD36 |
Synonyms | CD36; CD36 molecule (thrombospondin receptor); CD36 antigen (collagen type I receptor, thrombospondin receptor); platelet glycoprotein 4; FAT; GP3B; GP4; GPIV; SCARB3; GPIIIB; PAS IV; PAS-4 protein; glycoprotein IIIb; cluster determinant 36; fatty acid translocase; platelet glycoprotein IV; scavenger receptor class B, member 3; leukocyte differentiation antigen CD36; CHDS7; PASIV; BDPLT10; |
Gene ID | 948 |
mRNA Refseq | NM_000072 |
Protein Refseq | NP_000063 |
MIM | 173510 |
UniProt ID | P16671 |
◆ Recombinant Proteins | ||
Cd36-7170M | Recombinant Mouse Cd36 Protein, His-tagged | +Inquiry |
CD36-001M | Recombinant Monkey CD36 Protein | +Inquiry |
Cd36-834M | Recombinant Mouse Cd36 Protein, MYC/DDK-tagged | +Inquiry |
CD36-2432C | Recombinant Chicken CD36 | +Inquiry |
CD36-96C | Recombinant Cynomolgus CD36, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD36-2400MCL | Recombinant Mouse CD36 cell lysate | +Inquiry |
CD36-1236RCL | Recombinant Rat CD36 cell lysate | +Inquiry |
CD36-2539HCL | Recombinant Human CD36 cell lysate | +Inquiry |
CD36-1109CCL | Recombinant Cynomolgus CD36 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD36 Products
Required fields are marked with *
My Review for All CD36 Products
Required fields are marked with *
0
Inquiry Basket