Recombinant Human CD37 Full Length Transmembrane protein, His-tagged
| Cat.No. : | CD37-0295H |
| Product Overview : | Recombinant Human CD37 protein(P11049)(1-281aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-281aa |
| Form : | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| AA Sequence : | MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | CD37 CD37 molecule [ Homo sapiens ] |
| Official Symbol | CD37 |
| Synonyms | CD37; CD37 molecule; CD37 antigen; leukocyte antigen CD37; TSPAN26; tspan-26; tetraspanin-26; leukocyte surface antigen CD37; cell differentiation antigen 37; GP52-40; MGC120234; |
| Gene ID | 951 |
| mRNA Refseq | NM_001040031 |
| Protein Refseq | NP_001035120 |
| MIM | 151523 |
| UniProt ID | P11049 |
| ◆ Cell & Tissue Lysates | ||
| CD37-7678HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
| CD37-7677HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD37 Products
Required fields are marked with *
My Review for All CD37 Products
Required fields are marked with *



