Recombinant Human CD37 Full Length Transmembrane protein, His-tagged
Cat.No. : | CD37-0295H |
Product Overview : | Recombinant Human CD37 protein(P11049)(1-281aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-281aa |
Form : | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
AA Sequence : | MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CD37 CD37 molecule [ Homo sapiens ] |
Official Symbol | CD37 |
Synonyms | CD37; CD37 molecule; CD37 antigen; leukocyte antigen CD37; TSPAN26; tspan-26; tetraspanin-26; leukocyte surface antigen CD37; cell differentiation antigen 37; GP52-40; MGC120234; |
Gene ID | 951 |
mRNA Refseq | NM_001040031 |
Protein Refseq | NP_001035120 |
MIM | 151523 |
UniProt ID | P11049 |
◆ Recombinant Proteins | ||
RFL19534HF | Recombinant Full Length Human Leukocyte Antigen Cd37(Cd37) Protein, His-Tagged | +Inquiry |
CD37-906R | Recombinant Rat CD37 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD37-69H | Recombinant Human CD37 protein, hFc-tagged | +Inquiry |
RFL20204RF | Recombinant Full Length Rat Leukocyte Antigen Cd37(Cd37) Protein, His-Tagged | +Inquiry |
CD37-154H | Recombinant Human CD37 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD37-7677HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
CD37-7678HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD37 Products
Required fields are marked with *
My Review for All CD37 Products
Required fields are marked with *