Recombinant Human CD37 Protein, C-His-tagged
Cat.No. : | CD37-193H |
Product Overview : | Recombinant Human CD37 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Tetra-spans transmembrane family (TSTF) members (CD9, CD37, CD53, CD63, CD81 and CD82) are cell-surface proteins that are characterized by the presence of four hydrophobic, membrane-spanning domains. TSTF members can mediate signal transduction events influencing the regulation of cell development, adhesion, activation, growth and motility. The human CD37 gene maps to chromosome 19p13.3 and encodes a 281 amino acid protein. CD37 is a cell surface glycoprotein that can complex with integrins and other TSTF proteins and may play a role in T cell-B cell interactions. CD37 is strongly expressed on normal and neoplastic mature sIg+ B cells and is detected at low levels on resting and activated T cells, neutrophils, granulocytes and monocytes. Transgenic mouse models elicit no changes in development and cellular composition of lymphoid organs where CD37 is lacking. |
Molecular Mass : | ~14 kDa |
AA Sequence : | RAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD37 CD37 molecule [ Homo sapiens (human) ] |
Official Symbol | CD37 |
Synonyms | CD37; CD37 molecule; CD37 antigen; leukocyte antigen CD37; TSPAN26; tspan-26; tetraspanin-26; leukocyte surface antigen CD37; cell differentiation antigen 37; GP52-40; MGC120234; |
Gene ID | 951 |
mRNA Refseq | NM_001040031 |
Protein Refseq | NP_001035120 |
MIM | 151523 |
UniProt ID | P11049 |
◆ Recombinant Proteins | ||
CD37-1482B | Recombinant Bovine CD37 Full Length Transmembrane protein, His-tagged | +Inquiry |
CD37-71H | Recombinant Human CD37 protein, Fc-tagged | +Inquiry |
CD37-661H | Recombinant Human CD37 protein, His-tagged | +Inquiry |
CD37-4806H | Active Recombinant Human CD37 Full Length Transmembrane protein(VLPs) | +Inquiry |
CD37-5348H | Recombinant Human CD37 Protein (Arg112-Asn241), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD37-7678HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
CD37-7677HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD37 Products
Required fields are marked with *
My Review for All CD37 Products
Required fields are marked with *