Recombinant Human CD37 Protein, C-His-tagged
| Cat.No. : | CD37-193H |
| Product Overview : | Recombinant Human CD37 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Tetra-spans transmembrane family (TSTF) members (CD9, CD37, CD53, CD63, CD81 and CD82) are cell-surface proteins that are characterized by the presence of four hydrophobic, membrane-spanning domains. TSTF members can mediate signal transduction events influencing the regulation of cell development, adhesion, activation, growth and motility. The human CD37 gene maps to chromosome 19p13.3 and encodes a 281 amino acid protein. CD37 is a cell surface glycoprotein that can complex with integrins and other TSTF proteins and may play a role in T cell-B cell interactions. CD37 is strongly expressed on normal and neoplastic mature sIg+ B cells and is detected at low levels on resting and activated T cells, neutrophils, granulocytes and monocytes. Transgenic mouse models elicit no changes in development and cellular composition of lymphoid organs where CD37 is lacking. |
| Molecular Mass : | ~14 kDa |
| AA Sequence : | RAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | CD37 CD37 molecule [ Homo sapiens (human) ] |
| Official Symbol | CD37 |
| Synonyms | CD37; CD37 molecule; CD37 antigen; leukocyte antigen CD37; TSPAN26; tspan-26; tetraspanin-26; leukocyte surface antigen CD37; cell differentiation antigen 37; GP52-40; MGC120234; |
| Gene ID | 951 |
| mRNA Refseq | NM_001040031 |
| Protein Refseq | NP_001035120 |
| MIM | 151523 |
| UniProt ID | P11049 |
| ◆ Recombinant Proteins | ||
| CD37-154H | Recombinant Human CD37 Protein, Fc-tagged | +Inquiry |
| CD37-69H | Recombinant Human CD37 protein, hFc-tagged | +Inquiry |
| CD37-5348H | Recombinant Human CD37 Protein (Arg112-Asn241), C-His tagged | +Inquiry |
| RFL611BF | Recombinant Full Length Bovine Leukocyte Antigen Cd37(Cd37) Protein, His-Tagged | +Inquiry |
| CD37-0943H | Recombinant Human CD37 Protein (Thr110-Asn241), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD37-7678HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
| CD37-7677HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD37 Products
Required fields are marked with *
My Review for All CD37 Products
Required fields are marked with *



