Recombinant Human CD3D Protein, His-tagged
Cat.No. : | CD3D-137H |
Product Overview : | Recombinant human CD3D protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 171 |
Description : | The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. |
Form : | Lyophilized |
Molecular Mass : | 11 kDa |
AA Sequence : | MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD3D CD3d molecule, delta (CD3-TCR complex) [ Homo sapiens (human) ] |
Official Symbol | CD3D |
Synonyms | CD3D; CD3d molecule, delta (CD3-TCR complex); CD3d antigen, delta polypeptide (TiT3 complex) , T3D; T-cell surface glycoprotein CD3 delta chain; CD3 delta; OKT3, delta chain; CD3 antigen, delta subunit; T-cell receptor T3 delta chain; CD3d antigen, delta polypeptide (TiT3 complex); T3D; CD3-DELTA; |
Gene ID | 915 |
mRNA Refseq | NM_000732 |
Protein Refseq | NP_000723 |
MIM | 186790 |
UniProt ID | P04234 |
◆ Cell & Tissue Lysates | ||
CD3D-1381MCL | Recombinant Mouse CD3D cell lysate | +Inquiry |
CD3D-1466CCL | Recombinant Cynomolgus CD3D cell lysate | +Inquiry |
CD3D-1274HCL | Recombinant Human CD3D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3D Products
Required fields are marked with *
My Review for All CD3D Products
Required fields are marked with *
0
Inquiry Basket