Recombinant Human CD3E protein, GST-tagged

• Cat.No.: CD3E-2663H
• Product Overview: Recombinant Human CD3E protein(P07766)(23-207aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 23-207aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.7 kDa
• AA Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ]
• Official Symbol: CD3E
• Synonyms: CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell antigen receptor complex, epsilon subunit of T3; T3E; TCRE; FLJ18683
• Gene ID: 916
• mRNA Refseq: NM_000733
• Protein Refseq: NP_000724
• UniProt ID: P07766