Recombinant Human CD3E protein, GST-tagged
Cat.No. : | CD3E-2663H |
Product Overview : | Recombinant Human CD3E protein(P07766)(23-207aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 23-207aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.7 kDa |
AA Sequence : | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ] |
Official Symbol | CD3E |
Synonyms | CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell antigen receptor complex, epsilon subunit of T3; T3E; TCRE; FLJ18683; |
Gene ID | 916 |
mRNA Refseq | NM_000733 |
Protein Refseq | NP_000724 |
UniProt ID | P07766 |
◆ Recombinant Proteins | ||
Cd3E&D-309M | Recombinant Mouse Cd3E&D-309M, His-Fc & Flag-Fc tag | +Inquiry |
CD3E-3081C | Recombinant Canine CD3E protein, His-tagged | +Inquiry |
CD3E-10952H | Recombinant Human CD3E, GST-tagged | +Inquiry |
CD3E-0249C | Recombinant Cynomolgus CD3E protein, hFc-tagged | +Inquiry |
CD3E-275H | Recombinant Human CD3E protein, His-tagged, Biotinylated, Primary Amine Labeling | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *
0
Inquiry Basket