Recombinant Human CD3EAP protein, GST-tagged
Cat.No. : | CD3EAP-8938H |
Product Overview : | Recombinant Human CD3EAP(2 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 2-110 a.a. |
Description : | CD3EAP played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGK RHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CD3EAP CD3e molecule, epsilon associated protein [ Homo sapiens ] |
Official Symbol | CD3EAP |
Synonyms | CD3EAP; CD3e molecule, epsilon associated protein; CD3e antigen, epsilon polypeptide associated protein; DNA-directed RNA polymerase I subunit RPA34; antisense to ERCC 1; ASE 1; CAST; CD3 epsilon associated protein; PAF49; A34.5; CD3E-associated protein; antisense to ERCC-1 protein; CD3-epsilon-associated protein; RNA polymerase I-associated factor PAF49; ASE-1; MGC118851; |
Gene ID | 10849 |
mRNA Refseq | NM_012099 |
Protein Refseq | NP_036231 |
MIM | 107325 |
UniProt ID | O15446 |
Chromosome Location | 19q13.3 |
Pathway | TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | DNA-directed RNA polymerase activity; |
◆ Recombinant Proteins | ||
CD3EAP-8938H | Recombinant Human CD3EAP protein, GST-tagged | +Inquiry |
CD3EAP-1460M | Recombinant Mouse CD3EAP Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd3eap-677M | Recombinant Mouse Cd3eap Protein, His-tagged | +Inquiry |
CD3EAP-3087M | Recombinant Mouse CD3EAP Protein | +Inquiry |
Cd3eap-2062M | Recombinant Mouse Cd3eap Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3EAP-7676HCL | Recombinant Human CD3EAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3EAP Products
Required fields are marked with *
My Review for All CD3EAP Products
Required fields are marked with *