"CD3EAP" Related Products

Recombinant Human CD3EAP protein, GST-tagged

Cat.No.: CD3EAP-8938H
Product Overview: Recombinant Human CD3EAP(2 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: CD3EAP played an important role in many functions.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.73 kDa
AA Sequence: EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGK RHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASA
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: CD3EAP CD3e molecule, epsilon associated protein [ Homo sapiens ]
Official Symbol: CD3EAP
Synonyms: CD3EAP; CD3e molecule, epsilon associated protein; CD3e antigen, epsilon polypeptide associated protein; DNA-directed RNA polymerase I subunit RPA34; antisense to ERCC 1; ASE 1; CAST; CD3 epsilon associated protein; PAF49; A34.5; CD3E-associated protein; antisense to ERCC-1 protein; CD3-epsilon-associated protein; RNA polymerase I-associated factor PAF49; ASE-1; MGC118851;
Gene ID: 10849
mRNA Refseq: NM_012099
Protein Refseq: NP_036231
MIM: 107325
UniProt ID: O15446
Chromosome Location: 19q13.3
Pathway: TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function: DNA-directed RNA polymerase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.