Recombinant Human CD3EAP protein, GST-tagged CD3EAP-8938H

Recombinant Human CD3EAP protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD3EAP protein, GST-tagged

Recombinant Human CD3EAP protein, GST-tagged

CD3EAP Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD3EAP-8938H
Product Overview : Recombinant Human CD3EAP(2 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : CD3EAP played an important role in many functions.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.73 kDa
AA Sequence : EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGK RHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : CD3EAP CD3e molecule, epsilon associated protein [ Homo sapiens ]
Official Symbol : CD3EAP
Synonyms : CD3EAP; CD3e molecule, epsilon associated protein; CD3e antigen, epsilon polypeptide associated protein; DNA-directed RNA polymerase I subunit RPA34; antisense to ERCC 1; ASE 1; CAST; CD3 epsilon associated protein; PAF49; A34.5; CD3E-associated protein; antisense to ERCC-1 protein; CD3-epsilon-associated protein; RNA polymerase I-associated factor PAF49; ASE-1; MGC118851;
Gene ID : 10849
mRNA Refseq : NM_012099
Protein Refseq : NP_036231
MIM : 107325
UniProt ID : O15446
Chromosome Location : 19q13.3
Pathway : TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function : DNA-directed RNA polymerase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy