Recombinant Human CD3G
Cat.No. : | CD3G-26368TH |
Product Overview : | Recombinant fragment of Human CD3G with proprietary tag; predicited MWt 35.42 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 89 amino acids |
Description : | The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. |
Molecular Weight : | 35.420kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN |
Sequence Similarities : | Contains 1 Ig-like (immunoglobulin-like) domain.Contains 1 ITAM domain. |
Gene Name | CD3G CD3g molecule, gamma (CD3-TCR complex) [ Homo sapiens ] |
Official Symbol | CD3G |
Synonyms | CD3G; CD3g molecule, gamma (CD3-TCR complex); CD3g antigen, gamma polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 gamma chain; |
Gene ID | 917 |
mRNA Refseq | NM_000073 |
Protein Refseq | NP_000064 |
Uniprot ID | P09693 |
Chromosome Location | 11q23 |
Pathway | Adaptive Immune System, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; |
Function | T cell receptor binding; protein heterodimerization activity; receptor activity; receptor signaling complex scaffold activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
CD3G-1011H | Recombinant Human CD3G protein, Fc-tagged | +Inquiry |
CD3G-370H | Recombinant Human CD3G | +Inquiry |
CD3G-678H | Recombinant Human CD3G Protein, His-tagged | +Inquiry |
CD3G-170H | Recombinant Human CD3G Protein, C-His-tagged | +Inquiry |
CD3G-738R | Recombinant Rhesus monkey CD3G Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3G-7675HCL | Recombinant Human CD3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3G Products
Required fields are marked with *
My Review for All CD3G Products
Required fields are marked with *
0
Inquiry Basket