Recombinant Human CD3G Protein, GST-Tagged
| Cat.No. : | CD3G-0805H |
| Product Overview : | Human CD3G partial ORF (NP_000064, 23 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 35.53 kDa |
| AA Sequence : | QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CD3G CD3g molecule, gamma (CD3-TCR complex) [ Homo sapiens ] |
| Official Symbol | CD3G |
| Synonyms | CD3G; CD3g molecule, gamma (CD3-TCR complex); CD3g antigen, gamma polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD3g molecule, epsilon (CD3-TCR complex); T-cell antigen receptor complex, gamma subunit of T3; T3G; CD3-GAMMA; FLJ17620; FLJ17664; FLJ79544; FLJ94613; MGC138597; |
| Gene ID | 917 |
| mRNA Refseq | NM_000073 |
| Protein Refseq | NP_000064 |
| UniProt ID | P09693 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3G Products
Required fields are marked with *
My Review for All CD3G Products
Required fields are marked with *
