Recombinant Human CD3G Protein, GST-Tagged
Cat.No. : | CD3G-0805H |
Product Overview : | Human CD3G partial ORF (NP_000064, 23 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 35.53 kDa |
AA Sequence : | QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD3G CD3g molecule, gamma (CD3-TCR complex) [ Homo sapiens ] |
Official Symbol | CD3G |
Synonyms | CD3G; CD3g molecule, gamma (CD3-TCR complex); CD3g antigen, gamma polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD3g molecule, epsilon (CD3-TCR complex); T-cell antigen receptor complex, gamma subunit of T3; T3G; CD3-GAMMA; FLJ17620; FLJ17664; FLJ79544; FLJ94613; MGC138597; |
Gene ID | 917 |
mRNA Refseq | NM_000073 |
Protein Refseq | NP_000064 |
UniProt ID | P09693 |
◆ Recombinant Proteins | ||
CD3G-1251R | Recombinant Rat CD3G Protein | +Inquiry |
CD3G-170H | Recombinant Human CD3G Protein, C-His-tagged | +Inquiry |
CD3G-1011H | Recombinant Human CD3G protein, Fc-tagged | +Inquiry |
CD3G-2633H | Recombinant Human CD3G Protein, His (Fc)-Avi-tagged | +Inquiry |
CD3G-1461M | Recombinant Mouse CD3G Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3G-7675HCL | Recombinant Human CD3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3G Products
Required fields are marked with *
My Review for All CD3G Products
Required fields are marked with *