Recombinant Human CD3G protein, His&Myc-tagged
Cat.No. : | CD3G-4533H |
Product Overview : | Recombinant Human CD3G protein(P09693)(23-116aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 23-116aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS |
Gene Name | CD3G CD3g molecule, gamma (CD3-TCR complex) [ Homo sapiens ] |
Official Symbol | CD3G |
Synonyms | CD3G; CD3g molecule, gamma (CD3-TCR complex); CD3g antigen, gamma polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD3g molecule, epsilon (CD3-TCR complex); T-cell antigen receptor complex, gamma subunit of T3; T3G; CD3-GAMMA; FLJ17620; FLJ17664; FLJ79544; FLJ94613; MGC138597; |
Gene ID | 917 |
mRNA Refseq | NM_000073 |
Protein Refseq | NP_000064 |
UniProt ID | P09693 |
◆ Recombinant Proteins | ||
CD3G-564R | Recombinant Rhesus Macaque CD3G Protein, His (Fc)-Avi-tagged | +Inquiry |
CD3G-4903H | Recombinant Human CD3G protein, Fc-tagged | +Inquiry |
CD3G-2633H | Recombinant Human CD3G Protein, His (Fc)-Avi-tagged | +Inquiry |
CD3G-1461M | Recombinant Mouse CD3G Protein, His (Fc)-Avi-tagged | +Inquiry |
CD3G-139C | Recombinant Cynomolgus Monkey CD3G Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3G-7675HCL | Recombinant Human CD3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3G Products
Required fields are marked with *
My Review for All CD3G Products
Required fields are marked with *