Recombinant Human CD47 protein, T7/His-tagged
| Cat.No. : | CD47-90H |
| Product Overview : | Recombinant human CD47, which carry single Ig-like V type domain cDNA (19 – 127 aa, derived from BC012884) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 19-127 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRD IYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETII |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro non-glycosylated CD47 longest extracellular domain protein mediated "don"t eat me" signal regulation study for cancer cell imgration, T cell activation et al. with this protein as either coating matrix protein or soluble factor.2. May be used as CD47 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As potential cancer diagnostic biomarker protein.5. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | CD47 CD47 molecule [ Homo sapiens ] |
| Official Symbol | CD47 |
| Synonyms | CD47; CD47 molecule; CD47 antigen (Rh related antigen, integrin associated signal transducer) , MER6; leukocyte surface antigen CD47; antigen identified by monoclonal 1D8; antigenic surface determinant protein OA3; CD47 glycoprotein; IAP; integrin assoc |
| Gene ID | 961 |
| mRNA Refseq | NM_001777 |
| Protein Refseq | NP_001768 |
| MIM | 601028 |
| UniProt ID | Q08722 |
| Chromosome Location | 3q13.1-q13.2 |
| Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hemostasis, organism-specific biosystem |
| Function | protein binding; thrombospondin receptor activity; |
| ◆ Recombinant Proteins | ||
| Cd47-647MF | Recombinant Mouse Cd47 Protein, His-tagged, FITC conjugated | +Inquiry |
| CD47-3094M | Recombinant Mouse Cd47 protein, His-tagged | +Inquiry |
| Cd47-7480RF | Recombinant Rat Cd47 Protein, hFc-tagged, FITC conjugated | +Inquiry |
| CD47-7865HAF555 | Recombinant Human CD47 Protein, Alexa Fluor 555 conjugated | +Inquiry |
| CD47-384M | Recombinant Mouse CD47 protein, Mouse IgG2a Fc-tagged, low endotoxin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD47-1363RCL | Recombinant Rat CD47 cell lysate | +Inquiry |
| CD47-850HCL | Recombinant Human CD47 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD47 Products
Required fields are marked with *
My Review for All CD47 Products
Required fields are marked with *
