Recombinant Human CD48 Protein, GST-tagged
| Cat.No. : | CD48-10960H |
| Product Overview : | Recombinant Human CD48 Protein()(27-220 aa), fused to GST tag, was expressed in E. coli. |
| Availability | November 06, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 27-220 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CD48 CD48 molecule [ Homo sapiens ] |
| Official Symbol | CD48 |
| Synonyms | CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein) , CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2; TCT.1; BCM1 surface antigen; leukocyte antigen MEM-102; B-lymphocyte activation marker BLAST-1; CD48 antigen (B-cell membrane protein); BCM1; BLAST1; MEM-102; |
| Gene ID | 962 |
| mRNA Refseq | NM_001256030.1 |
| Protein Refseq | NP_001242959.1 |
| MIM | 109530 |
| UniProt ID | P09326 |
| ◆ Recombinant Proteins | ||
| CD48-252H | Active Recombinant Human CD48 protein, hFc-tagged | +Inquiry |
| CD48-1256R | Recombinant Rat CD48 Protein | +Inquiry |
| CD48-867MAF647 | Active Recombinant Mouse CD48 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| Cd48-486MF | Recombinant Mouse Cd48 Protein, Fc-tagged, FITC conjugated | +Inquiry |
| CD48-2179H | Active Recombinant Human CD48 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD48-3044HCL | Recombinant Human CD48 cell lysate | +Inquiry |
| CD48-1258RCL | Recombinant Rat CD48 cell lysate | +Inquiry |
| CD48-2468MCL | Recombinant Mouse CD48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD48 Products
Required fields are marked with *
My Review for All CD48 Products
Required fields are marked with *
