Recombinant Human CD53 Protein
| Cat.No. : | CD53-0832H |
| Product Overview : | Human CD53 full-length ORF (NP_000551.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
| Form : | Liquid |
| Molecular Mass : | 24.3 kDa |
| AA Sequence : | MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | CD53 CD53 molecule [ Homo sapiens ] |
| Official Symbol | CD53 |
| Synonyms | CD53; CD53 molecule; CD53 antigen, MOX44; leukocyte surface antigen CD53; TSPAN25; tspan-25; CD53 antigen; tetraspanin-25; CD53 glycoprotein; cell surface antigen; CD53 tetraspan antigen; transmembrane glycoprotein; cell surface glycoprotein CD53; antigen MOX44 identified by monoclonal MRC-OX44; MOX44; |
| Gene ID | 963 |
| mRNA Refseq | NM_000560 |
| Protein Refseq | NP_000551 |
| MIM | 151525 |
| UniProt ID | P19397 |
| ◆ Recombinant Proteins | ||
| RFL32283BF | Recombinant Full Length Bovine Leukocyte Surface Antigen Cd53(Cd53) Protein, His-Tagged | +Inquiry |
| Cd53-844M | Recombinant Mouse Cd53 Protein, MYC/DDK-tagged | +Inquiry |
| CD53-503H | Recombinant Human CD53 Protein, His&GST-tagged | +Inquiry |
| CD53-3002HF | Recombinant Full Length Human CD53 Protein, GST-tagged | +Inquiry |
| CD53-158M | Recombinant Mouse Cd53, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD53-808MCL | Recombinant Mouse CD53 cell lysate | +Inquiry |
| CD53-1122CCL | Recombinant Cynomolgus CD53 cell lysate | +Inquiry |
| CD53-1018CCL | Recombinant Cynomolgus CD53 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD53 Products
Required fields are marked with *
My Review for All CD53 Products
Required fields are marked with *
