Recombinant Human CD53 Protein

Cat.No. : CD53-0832H
Product Overview : Human CD53 full-length ORF (NP_000551.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
Form : Liquid
Molecular Mass : 24.3 kDa
AA Sequence : MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name CD53 CD53 molecule [ Homo sapiens ]
Official Symbol CD53
Synonyms CD53; CD53 molecule; CD53 antigen, MOX44; leukocyte surface antigen CD53; TSPAN25; tspan-25; CD53 antigen; tetraspanin-25; CD53 glycoprotein; cell surface antigen; CD53 tetraspan antigen; transmembrane glycoprotein; cell surface glycoprotein CD53; antigen MOX44 identified by monoclonal MRC-OX44; MOX44;
Gene ID 963
mRNA Refseq NM_000560
Protein Refseq NP_000551
MIM 151525
UniProt ID P19397

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD53 Products

Required fields are marked with *

My Review for All CD53 Products

Required fields are marked with *

0
cart-icon