Recombinant Human CD53 Protein, GST-Tagged
Cat.No. : | CD53-0833H |
Product Overview : | Human CD53 full-length ORF (NP_000551.1, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD53 CD53 molecule [ Homo sapiens ] |
Official Symbol | CD53 |
Synonyms | CD53; CD53 molecule; CD53 antigen, MOX44; leukocyte surface antigen CD53; TSPAN25; tspan-25; CD53 antigen; tetraspanin-25; CD53 glycoprotein; cell surface antigen; CD53 tetraspan antigen; transmembrane glycoprotein; cell surface glycoprotein CD53; antigen MOX44 identified by monoclonal MRC-OX44; MOX44; |
Gene ID | 963 |
mRNA Refseq | NM_000560 |
Protein Refseq | NP_000551 |
MIM | 151525 |
UniProt ID | P19397 |
◆ Recombinant Proteins | ||
HK1-318H | Recombinant Human HK1 Protein, MYC/DDK-tagged | +Inquiry |
NAT9-2950R | Recombinant Rhesus monkey NAT9 Protein, His-tagged | +Inquiry |
SAG-283H | Recombinant Human SAG Protein, MYC/DDK-tagged | +Inquiry |
BDH1-181H | Recombinant Human BDH1 Protein, GST-tagged | +Inquiry |
FABP3-0007H | Recombinant Human FABP3 Protein | +Inquiry |
◆ Native Proteins | ||
PLF4-88H | Active Native Human PF 4 | +Inquiry |
PLG-268B | Active Native Bovine glu-Plasminogen | +Inquiry |
APOH-4217H | Native Human APOH protein | +Inquiry |
CP-5326H | Native Human Ceruloplasmin (ferroxidase) | +Inquiry |
Ferritin-026H | Native Human Ferritin Protein, holo form | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1R2-1302RCL | Recombinant Rat IL1R2 cell lysate | +Inquiry |
PI15-3209HCL | Recombinant Human PI15 293 Cell Lysate | +Inquiry |
APOL4-99HCL | Recombinant Human APOL4 cell lysate | +Inquiry |
B2M-1656MCL | Recombinant Mouse B2M cell lysate | +Inquiry |
KLK9-4900HCL | Recombinant Human KLK9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD53 Products
Required fields are marked with *
My Review for All CD53 Products
Required fields are marked with *
0
Inquiry Basket