Recombinant Human CD58 Protein

Cat.No. : CD58-0834H
Product Overview : Human CD58 full-length ORF (NP_001770.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
Form : Liquid
Molecular Mass : 28.1 kDa
AA Sequence : MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name CD58 CD58 molecule [ Homo sapiens ]
Official Symbol CD58
Synonyms CD58; CD58 molecule; CD58 antigen, (lymphocyte function associated antigen 3), LFA3; lymphocyte function-associated antigen 3; surface glycoprotein LFA-3; CD58 antigen, (lymphocyte function-associated antigen 3); ag3; LFA3; LFA-3; FLJ23181; FLJ43722;
Gene ID 965
mRNA Refseq NM_001144822
Protein Refseq NP_001138294
MIM 153420
UniProt ID P19256

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD58 Products

Required fields are marked with *

My Review for All CD58 Products

Required fields are marked with *

0
cart-icon