Recombinant Human CD58 Protein
| Cat.No. : | CD58-0834H |
| Product Overview : | Human CD58 full-length ORF (NP_001770.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009] |
| Form : | Liquid |
| Molecular Mass : | 28.1 kDa |
| AA Sequence : | MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | CD58 CD58 molecule [ Homo sapiens ] |
| Official Symbol | CD58 |
| Synonyms | CD58; CD58 molecule; CD58 antigen, (lymphocyte function associated antigen 3), LFA3; lymphocyte function-associated antigen 3; surface glycoprotein LFA-3; CD58 antigen, (lymphocyte function-associated antigen 3); ag3; LFA3; LFA-3; FLJ23181; FLJ43722; |
| Gene ID | 965 |
| mRNA Refseq | NM_001144822 |
| Protein Refseq | NP_001138294 |
| MIM | 153420 |
| UniProt ID | P19256 |
| ◆ Recombinant Proteins | ||
| CD58-151H | Recombinant Human CD58 Protein, DYKDDDDK-tagged | +Inquiry |
| CD58-165H | Recombinant Human CD58 Protein, His-tagged | +Inquiry |
| CD58-0834H | Recombinant Human CD58 Protein | +Inquiry |
| CD58-005H | Recombinant Human CD58 Protein, DDK/His-tagged | +Inquiry |
| CD58-745R | Recombinant Rhesus monkey CD58 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD58-797CCL | Recombinant Cynomolgus CD58 cell lysate | +Inquiry |
| CD58-1127HCL | Recombinant Human CD58 cell lysate | +Inquiry |
| CD58-097HKCL | Human CD58 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD58 Products
Required fields are marked with *
My Review for All CD58 Products
Required fields are marked with *




