Recombinant Human CD6 Protein, GST-Tagged
Cat.No. : | CD6-0839H |
Product Overview : | Human CD6 partial ORF (NP_006716, 308 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion molecule. The gene product is important for continuation of T cell activation. This gene may be associated with susceptibility to multiple sclerosis (PMID: 19525953, 21849685). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 35.97 kDa |
AA Sequence : | CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD6 CD6 molecule [ Homo sapiens ] |
Official Symbol | CD6 |
Synonyms | CD6; CD6 molecule; CD6 antigen; T-cell differentiation antigen CD6; Tp120; T12; TP120; FLJ44171; |
Gene ID | 923 |
mRNA Refseq | NM_001254750 |
Protein Refseq | NP_001241679 |
MIM | 186720 |
UniProt ID | P30203 |
◆ Recombinant Proteins | ||
Cd6-5170M | Active Recombinant Mouse Cd6 protein(Met1-Val243), hFc-tagged | +Inquiry |
CD6-018H | Recombinant Human CD6 protein, His-tagged | +Inquiry |
CD6-0839H | Recombinant Human CD6 Protein, GST-Tagged | +Inquiry |
Cd6-5665M | Recombinant Mouse Cd6 protein, His & T7-tagged | +Inquiry |
Cd6-5666R | Recombinant Rat Cd6 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD6-1807MCL | Recombinant Mouse CD6 cell lysate | +Inquiry |
CD6-958RCL | Recombinant Rat CD6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD6 Products
Required fields are marked with *
My Review for All CD6 Products
Required fields are marked with *
0
Inquiry Basket