Recombinant Human CD68 protein

Cat.No. : CD68-33H
Product Overview : Recombinant human CD68 protein, fused to His-tag at N-terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 22-319aa
Description : This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.
Form : Liquid
AASequence : NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS
Molecular Mass : 34.1 kDa (323aa)
Purity : > 85% by SDS-PAGE
Application : SDS-PAGE, Denatured
Note : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 1M urea, 10% glycerol, 0.1M NaCl
Concentration : 1 mg/mL (determined by Bradford assay)
Reference : 1. Holness CL., et al. (1993) Blood. 81(6):1607-13. 2. Shun CT., et al. (2009) J Infect Dis. 199:1488-1496
Gene Name CD68 CD68 molecule [ Homo sapiens (human) ]
Official Symbol CD68
Synonyms CD68; CD68 molecule; GP110; LAMP4; SCARD1; macrosialin; CD68 antigen; macrophage antigen CD68; scavenger receptor class D, member 1
Gene ID 968
mRNA Refseq NM_001251
Protein Refseq NP_001242
MIM 153634
UniProt ID P34810

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD68 Products

Required fields are marked with *

My Review for All CD68 Products

Required fields are marked with *

0
cart-icon
0
compare icon