| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
22-319aa |
| Description : |
This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms. |
| Form : |
Liquid |
| AASequence : |
NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS |
| Molecular Mass : |
34.1 kDa (323aa) |
| Purity : |
> 85% by SDS-PAGE |
| Application : |
SDS-PAGE, Denatured |
| Note : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : |
20mM Tris-HCl buffer (pH 8.0) containing 1M urea, 10% glycerol, 0.1M NaCl |
| Concentration : |
1 mg/mL (determined by Bradford assay) |
| Reference : |
1. Holness CL., et al. (1993) Blood. 81(6):1607-13.
2. Shun CT., et al. (2009) J Infect Dis. 199:1488-1496 |
