Recombinant Human CD69 molecule protein, His&Avi tagged, Biotinylated

Cat.No. : CD69-2225HB
Product Overview : Biotinylated recombinant Human CD69 molecule protein (62-199 aa) with His&Avi tag was expressed in HEK293.
Availability September 25, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&His
Protein Length : 62-199 aa
Description : This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
Conjugation/Label : Biotin
Form : Lyophilized
Molecular Mass : 18 kDa
AA Sequence : SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYKHHHHHHGLNDIFEAQKIEWHE
Endotoxin : < 1 EU/μg by LAL.
Purity : > 85 % by SDS-PAGE
Labelling Efficiency : 1.78 by HABA
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 5 % Trehalose, 5 % Manitol
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.46 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.
Conjugation : Biotin
Gene Name CD69 CD69 molecule [ Homo sapiens (human) ]
Official Symbol CD69
Synonyms CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; leukocyte surface antigen Leu-23; early T-cell activation antigen p60; early lymphocyte activation antigen; activation inducer molecule (AIM/CD69); C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell activation antigen); AIM; EA1; MLR-3; GP32/28; BL-AC/P26
Gene ID 969
mRNA Refseq NM_001781
Protein Refseq NP_001772
MIM 107273
UniProt ID Q07108

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD69 Products

Required fields are marked with *

My Review for All CD69 Products

Required fields are marked with *

0
cart-icon
0
compare icon