Recombinant Human CD69 molecule protein, His&Avi tagged, Biotinylated
Cat.No. : | CD69-2225HB |
Product Overview : | Biotinylated recombinant Human CD69 molecule protein (62-199 aa) with His&Avi tag was expressed in HEK293. |
Availability | September 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&His |
Protein Length : | 62-199 aa |
Description : | This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. |
Conjugation/Label : | Biotin |
Form : | Lyophilized |
Molecular Mass : | 18 kDa |
AA Sequence : | SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYKHHHHHHGLNDIFEAQKIEWHE |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 85 % by SDS-PAGE |
Labelling Efficiency : | 1.78 by HABA |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 5 % Trehalose, 5 % Manitol |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.46 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
Conjugation : | Biotin |
Gene Name | CD69 CD69 molecule [ Homo sapiens (human) ] |
Official Symbol | CD69 |
Synonyms | CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; leukocyte surface antigen Leu-23; early T-cell activation antigen p60; early lymphocyte activation antigen; activation inducer molecule (AIM/CD69); C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell activation antigen); AIM; EA1; MLR-3; GP32/28; BL-AC/P26 |
Gene ID | 969 |
mRNA Refseq | NM_001781 |
Protein Refseq | NP_001772 |
MIM | 107273 |
UniProt ID | Q07108 |
◆ Recombinant Proteins | ||
CD69-1101H | Recombinant Human CD69 Protein (Ser62-Lys199), His tagged | +Inquiry |
CD69-168H | Recombinant Human CD69 Protein, His-tagged | +Inquiry |
CD69-1802R | Recombinant Rhesus Monkey CD69 Protein, hIgG1-tagged | +Inquiry |
Cd69-4522H | Recombinant Human Cd69 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
CD69-5844H | Recombinant Human CD69 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD69-2573HCL | Recombinant Human CD69 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD69 Products
Required fields are marked with *
My Review for All CD69 Products
Required fields are marked with *