Recombinant Human CD69 molecule protein, His&Avi tagged, Biotinylated

• Cat.No.: CD69-2225HB
• Product Overview: Biotinylated recombinant Human CD69 molecule protein (62-199 aa) with His&Avi tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Avi&His
• Protein Length: 62-199 aa
• Description: This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
• Conjugation/Label: Biotin
• Form: Lyophilized
• Molecular Mass: 18 kDa
• AA Sequence: SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYKHHHHHHGLNDIFEAQKIEWHE
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 85 % by SDS-PAGE
• Labelling Efficiency: 1.78 by HABA
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 5 % Trehalose, 5 % Manitol
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.46 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.
• Conjugation: Biotin

Gene Information

• Gene Name: CD69 CD69 molecule [ Homo sapiens (human) ]
• Official Symbol: CD69
• Synonyms: CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; leukocyte surface antigen Leu-23; early T-cell activation antigen p60; early lymphocyte activation antigen; activation inducer molecule (AIM/CD69); C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell activation antigen); AIM; EA1; MLR-3; GP32/28; BL-AC/P26
• Gene ID: 969
• mRNA Refseq: NM_001781
• Protein Refseq: NP_001772
• MIM: 107273
• UniProt ID: Q07108