Recombinant Human CD69 Protein, C-His-tagged
Cat.No. : | CD69-205H |
Product Overview : | Recombinant Human CD69 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD69, also known as Leu-23, is a type II transmembrane glycoprotein that is expressed on the surface of T cells, B cells, and NK cells. This phosphorylated disulfide-linked 28 to 32-kDa homodimer is constitutively expressed on a subset of thymocytes and platelets. It also acts as an activation antigen of lymphocytes, NK cells, neutrophils, and eosinophils. Studies have shown that stimulation of the T cell receptor (TCR) increases the expression of CD69 on the cell surface. The ability to detect the level of CD69 expression after TCR activation makes CD69 an ideal indicator of T cell activation. The FN50 antibody is widely used as a marker for T cell activation. |
Molecular Mass : | ~15 kDa |
AA Sequence : | SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD69 CD69 molecule [ Homo sapiens (human) ] |
Official Symbol | CD69 |
Synonyms | CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; leukocyte surface antigen Leu-23; early T-cell activation antigen p60; early lymphocyte activation antigen; activation inducer molecule (AIM/CD69); C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell activation antigen); AIM; EA1; MLR-3; GP32/28; BL-AC/P26; |
Gene ID | 969 |
mRNA Refseq | NM_001781 |
Protein Refseq | NP_001772 |
MIM | 107273 |
UniProt ID | Q07108 |
◆ Recombinant Proteins | ||
CD69-3101H | Recombinant Human CD69 Protein, MYC/DDK-tagged | +Inquiry |
CD69-1803R | Recombinant Rhesus Monkey CD69 Protein, hIgG4-tagged | +Inquiry |
CD69-3028HF | Recombinant Full Length Human CD69 Protein, GST-tagged | +Inquiry |
CD69-5364H | Recombinant Human CD69 Protein (Ser62-Lys199), C-His tagged | +Inquiry |
CD69-0844H | Recombinant Human CD69 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD69-2573HCL | Recombinant Human CD69 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD69 Products
Required fields are marked with *
My Review for All CD69 Products
Required fields are marked with *